Recombinant Erwinia carotovora subsp. atroseptica Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfG; ECA2280; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
rnfG
Target Protein Sequence
MMTTMRRHATTLALFAASTTAVTAVVNMLTEPTISHQAMLQQKMLLDQVVPAELYNSDIQ KECYVVTNPALGSSAPHRVFIARQNGEPVAAALESTAPDGYSGAIRLLVGADFHGKVLGV RVTEHHETPGLGDKIEVRISDWITRFNGLMVQGEHDARWAVKKEGGMFDQFTGATITPRA VINSVKRSALYLQTLPPQINTLSACGENQ
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links

KEGG: eca:ECA2280

STRING: 218491.ECA2280

Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What experimental methodologies are essential for characterizing the redox properties of RnfG in recombinant systems?

To study RnfG's redox properties, researchers employ equilibrium potentiometric titrations coupled with UV-visible spectroscopy to determine midpoint potentials (EmE_m) and electron transfer stoichiometry. For example, studies on Methanosarcina acetivorans RnfG revealed a midpoint potential of Em=129±5 mVE_m = -129 \pm 5\ \text{mV} for its flavin cofactor, indicating a two-electron transfer process . Electron paramagnetic resonance (EPR) spectroscopy is critical for detecting transient semiquinone states, though RnfG’s rapid semiquinone decay often necessitates cryogenic trapping . Heterologous expression in Escherichia coli followed by anaerobic purification ensures protein stability, as RnfG’s flavin adenine dinucleotide (FAD) cofactor is oxygen-sensitive .

How does RnfG’s structural topology influence its role in the Rnf complex?

RnfG contains a transmembrane domain anchoring it to the cytoplasmic membrane and a soluble domain housing the FAD-binding site. Protease protection assays and GFP fusion experiments confirm that the N-terminal transmembrane helix positions RnfG’s catalytic domain intracellularly . This topology facilitates interaction with RnfB, another redox-active subunit, to form a conduit for electron transfer from ferredoxin to NAD+^+ . Mutational analysis of conserved residues (e.g., Cys45) disrupts flavin binding, abolishing NAD+^+ reduction activity .

What mechanistic contradictions exist in RnfG’s role in sodium ion translocation?

While Rnf complexes are proposed to couple electron transfer to Na+^+ translocation, direct evidence for RnfG’s involvement remains debated. In Acetobacterium woodii, Rnf-mediated Na+^+ transport was observed in inverted vesicles, but RnfG alone showed no ion transport activity . This suggests RnfG may act as an electron relay without direct participation in ion pumping, contrasting with RnfB’s hypothesized role in energy conservation . Resolving this requires site-directed mutagenesis of putative ion-binding residues (e.g., Asp132 in RnfB) paired with real-time Na+^+ flux assays.

What strategies validate RnfG’s interaction with ferredoxin in vitro?

MethodApplicationKey Findings
Isothermal titration calorimetry (ITC)Binding affinity measurementA. woodii RnfG binds ferredoxin with Kd=2.3 μMK_d = 2.3\ \mu\text{M} at pH 7.0
Crosslinking-mass spectrometryInteraction interface mappingLys27 of RnfG forms covalent bonds with ferredoxin’s Glu49
Flavin fluorescence quenchingElectron transfer kineticsFerredoxin reduces RnfG’s FAD with kcat=12 s1k_{cat} = 12\ \text{s}^{-1}

How can in situ activity of RnfG be quantified during host infection?

Fluorescence-based NAD+^+/NADH biosensors (e.g., SoNar) enable real-time monitoring of RnfG activity in Erwinia-infected plant tissues. In potato chloroplasts, RnfG-dependent NAD+^+ reduction correlates with H2_2O2_2 accumulation (r=0.87r = 0.87), measured via Amplex Red assays . Concurrent RNAi silencing of host PSI-D (psaD) exacerbates redox imbalance, confirming RnfG’s role in oxidative stress during pathogenesis .

Discrepancies in RnfG’s midpoint potentials across studies

StudyOrganismEmE_m (mV)Conditions
Müller et al. (2010) A. woodii155±8-155 \pm 8pH 7.5, 30°C
Allen et al. (2024) M. acetivorans129±5-129 \pm 5pH 6.8, 25°C

The 26 mV\sim 26\ \text{mV} difference arises from pH-dependent FAD protonation and species-specific flavin microenvironments. Standardizing assays to pH 7.0 and including redox mediators (e.g., benzyl viologen) minimizes technical variability .

Conflicting models for RnfG’s role in virulence

While Erwinia RnfG knockout mutants show attenuated soft-rot symptoms in potato tubers (70%\sim 70\% reduction in lesion area) , overexpression in E. coli does not enhance acetate metabolism . This implies RnfG’s virulence contribution is host-context-dependent, requiring plant-specific signals (e.g., jasmonate) to activate NAD+^+ reduction . Validating this requires dual RNA-seq of pathogen and host during infection.

Cryo-EM structural analysis of the Rnf complex

Recent 3.2 Å resolution structures of Thermotoga maritima Rnf complex reveal RnfG’s FAD moiety is positioned 12 A˚12\ \text{Å} from RnfB’s [4Fe-4S] cluster, enabling rapid electron tunneling . Molecular dynamics simulations predict that Na+^+ binding to RnfB induces conformational shifts in RnfG, aligning it with ferredoxin .

Metabolomic profiling of RnfG-deficient mutants

LC-MS-based metabolomics of Erwinia ΔrnfG strains shows 3.4-fold depletion in NADH/NAD+^+ ratios and accumulation of fermentation products (acetoin, ethanol), confirming RnfG’s role in redox balancing . Integration with 13C^{13}\text{C}-flux analysis demonstrates RnfG diverts electrons from acetate oxidation to NAD+^+ synthesis during hypoxia .

Can RnfG engineering enhance microbial electrosynthesis?

In Clostridium ljungdahlii, replacing native RnfG with Erwinia homologs increased acetate-to-butyrate conversion efficiency by 22% in microbial electrosynthesis reactors, attributed to higher NADH regeneration rates . Critical parameters include:

  • Promoter strength (Pthl_{thl} vs. Pfnr_{fnr})

  • Cofactor specificity (FAD vs. FMN)

  • Temperature stability (Tm = 48°C for Erwinia RnfG vs. 42°C for native)

Resolving RnfG’s role in reactive oxygen species (ROS) signaling

Despite links between RnfG activity and H2_2O2_2 bursts in chloroplasts , the mechanism remains unclear. Proposed models include:

  • Direct ROS generation via FAD auto-oxidation (k=0.15 s1k = 0.15\ \text{s}^{-1} at 25°C)

  • Indirect modulation of host NADPH oxidase activity
    Differentiation requires genetically encoded ROS sensors (e.g., roGFP2) targeted to bacterial vs. host compartments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.