Recombinant Erwinia carotovora subsp. atroseptica Glutathione transport system permease protein gsiC (gsiC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
gsiC; ECA2833; Glutathione transport system permease protein GsiC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
gsiC
Target Protein Sequence
MLNYFIKRLLGLIPTLLIVMVLVFLFVHLLPGDPARLAAGREADAAVIEMVRQDLGLDKP LPHQFWHFLTNILQGDLGTSMVSKRPVTQEIALRFMPTFWLTVCSMAWAVIFGMAIGIVS AVWRNGWPDRIGMTLAVSGLSFPAFALGMLLMQIFSVELGWLPTVGADTWLHYILPSLTL GAAVAAVMARFTRASFVDVLQEDYMRTARAKGVRESLVVLKHGLRNALIPVVTMMGLQFG FLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEVLLFSLEFILINLLVDMLYAAIN PAIRYK
Uniprot No.

Target Background

Function
This protein is a component of the ABC transporter complex GsiABCD, involved in glutathione import. It is likely responsible for substrate translocation across the membrane.
Database Links

KEGG: eca:ECA2833

STRING: 218491.ECA2833

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the glutathione transport system permease protein gsiC and what is its function?

The glutathione transport system permease protein gsiC is a component of the GsiABCD transport system that facilitates the uptake of glutathione from the extracellular environment into bacterial cells. It functions as a transmembrane permease that forms part of the channel through which glutathione molecules are transported across the cell membrane. The gsiC protein specifically works within a complex that includes other components (GsiA, GsiB, and GsiD) to enable ATP-dependent glutathione import, which is critical for maintaining intracellular glutathione levels necessary for various cellular functions including oxidative stress response and metabolic regulation. In Erwinia carotovora subsp. atroseptica (reclassified as Pectobacterium atrosepticum), this protein plays a role in bacterial physiology and potentially in pathogenicity mechanisms, though its specific contribution to virulence requires further investigation .

How does the glutathione transport system function in bacterial cells?

The glutathione transport system in bacteria operates as an ATP-binding cassette (ABC) transporter complex consisting of multiple proteins. In the GsiABCD system, GsiA functions as the ATP-binding protein providing energy for transport, while GsiB serves as the substrate-binding protein that captures glutathione molecules in the periplasmic space. GsiC and GsiD form the transmembrane channel through which glutathione is transported into the cytoplasm.

The system operates through the following mechanism:

  • GsiB binds extracellular glutathione with high affinity

  • The glutathione-bound GsiB interacts with the transmembrane components GsiC and GsiD

  • GsiA hydrolyzes ATP to provide energy for conformational changes

  • These conformational changes allow glutathione to pass through the GsiC/GsiD channel into the cytoplasm

  • The system returns to its original conformation after transport is complete

This transport system is particularly important in bacterial adaptation to environmental stresses, as evidenced by studies on related systems in other bacteria. For example, in Cronobacter sakazakii, disruption of the homologous gsiD gene results in decreased glutathione uptake, leading to reduced stress tolerance, particularly under desiccation conditions .

What experimental approaches can be used to assess gsiC protein interaction with other components of the glutathione transport system?

To investigate gsiC protein interactions within the GsiABCD complex, researchers can employ several complementary experimental approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express His-tagged gsiC in E. coli or native host

    • Isolate protein complexes using anti-His antibodies

    • Identify interacting partners through mass spectrometry

    • Verify specific interactions with Western blot analysis

  • Bacterial Two-Hybrid System:

    • Create fusion constructs of gsiC with one domain of a split transcription factor

    • Create fusion constructs of potential partners (GsiA, GsiB, GsiD) with complementary domain

    • Co-transform into reporter strain and measure reporter gene expression

    • Quantify interaction strength through reporter activity

  • FRET (Fluorescence Resonance Energy Transfer):

    • Generate fluorescent protein fusions with gsiC and potential partners

    • Express in bacterial cells and monitor energy transfer

    • Calculate FRET efficiency to measure proximity and interaction

  • Cross-linking coupled with mass spectrometry:

    • Treat cells expressing gsiC with chemical cross-linkers

    • Isolate cross-linked protein complexes

    • Digest and analyze by mass spectrometry to identify interacting residues

    • Develop structural models based on cross-linking constraints

These approaches should be implemented in a factorial experimental design to systematically evaluate interactions under different conditions, as shown in the experimental design table below:

ExperimentgsiC TagPartner ProteinCondition 1 (pH)Condition 2 (Glutathione)
1--NormalAbsent
2+-NormalAbsent
3-+NormalAbsent
4++NormalAbsent
5--StressAbsent
6+-StressAbsent
7-+StressAbsent
8++StressAbsent
9--NormalPresent
10+-NormalPresent
11-+NormalPresent
12++NormalPresent
13--StressPresent
14+-StressPresent
15-+StressPresent
16++StressPresent

This design follows the principles of two-level factorial experimental design with four factors , allowing for evaluation of both main effects and interactions between experimental variables.

How does the function of gsiC in E. carotovora compare to homologous proteins in other bacterial species?

The glutathione transport system permease protein gsiC in E. carotovora subsp. atroseptica shares functional homology with permease components of glutathione transporters in other bacterial species, though with varying degrees of sequence similarity and potentially distinct regulatory mechanisms.

Comparative analysis reveals several key insights:

  • Functional conservation across species:

    • The basic function of glutathione transport appears conserved among GsiC homologs

    • Homologous transporters have been identified in E. coli O157:H7, Shigella flexneri, and Salmonella Typhimurium

    • In all these species, the permease component serves as part of the transmembrane channel for glutathione passage

  • Structural variations:

    • While the core transmembrane domains show conservation, the cytoplasmic and periplasmic loops often exhibit greater sequence divergence

    • These variations may contribute to species-specific regulatory interactions or substrate specificity differences

  • Regulatory context:

    • In E. carotovora, the regulatory network involving RsmA, rsmB, and RsmC affects various cellular processes including extracellular enzyme production and virulence factors

    • The integration of glutathione transport into these regulatory networks may differ between species

    • For example, in C. sakazakii, gsiD (another component of the same transport system) has been specifically linked to desiccation tolerance

  • Physiological significance:

    • The importance of glutathione transport may vary between species based on ecological niche and stress exposure

    • In plant pathogens like E. carotovora, glutathione transport may play roles in both normal metabolism and host-pathogen interactions

    • The physiological consequences of transport disruption (such as oxidative stress sensitivity) appear similar across species, suggesting functional conservation

The cross-species comparison provides valuable insights for researchers trying to understand the evolution of bacterial glutathione transport systems and may suggest conserved targets for broad-spectrum antimicrobial development.

What are the optimal conditions for expressing and purifying recombinant gsiC protein?

Successful expression and purification of recombinant gsiC protein requires optimization of several parameters due to its transmembrane nature. Based on experimental data and protocols for similar membrane proteins, the following conditions are recommended:

Expression System Optimization:

  • Host strain selection:

    • E. coli BL21(DE3) or C41(DE3)/C43(DE3) strains specifically designed for membrane protein expression

    • Consider Lemo21(DE3) for tight control of expression levels to prevent toxicity

  • Expression vector:

    • Use vectors with tightly controlled promoters (T7-lac or arabinose-inducible)

    • Incorporate N-terminal His-tag or dual tags (His-MBP) to improve solubility

    • Consider fusion partners that aid membrane protein folding

  • Culture conditions:

    • Lower temperature expression (16-20°C) after induction

    • Extended expression period (16-24 hours)

    • Supplementation with 0.5-1% glucose during initial growth phase

    • Induction at OD600 of 0.6-0.8 with reduced inducer concentration (0.1-0.5 mM IPTG)

Purification Protocol:

  • Cell lysis:

    • Mechanical disruption (sonication or high-pressure homogenization)

    • Buffer containing 50 mM Tris-HCl pH 8.0, 150-300 mM NaCl, 10% glycerol

    • Addition of protease inhibitor cocktail

  • Membrane fraction isolation:

    • Differential centrifugation (low-speed followed by ultracentrifugation)

    • Membrane solubilization using appropriate detergents (n-dodecyl-β-D-maltoside (DDM) at 1-2%, or LDAO at 1%)

  • Affinity purification:

    • IMAC using Ni-NTA resin for His-tagged protein

    • Gradual imidazole gradient (10-500 mM) for elution

    • Include 0.05-0.1% detergent in all purification buffers

  • Further purification:

    • Size exclusion chromatography to remove aggregates

    • Buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDM, 5% glycerol

  • Storage conditions:

    • Storage buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Addition of 5-50% glycerol for long-term storage

    • Aliquot and store at -80°C; avoid repeated freeze-thaw cycles

When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, and add glycerol to a final concentration of 50% for optimal stability during storage .

How can researchers design experiments to investigate the role of gsiC in bacterial stress response?

To investigate gsiC's role in bacterial stress response, researchers should implement a multifaceted experimental approach that examines both the molecular function of the protein and its physiological impact under various stress conditions.

1. Generation of Genetic Tools:

  • Create clean deletion mutants (ΔgsiC) using allelic exchange

  • Develop complementation strains (cpgsiC) by reintroducing gsiC under native or inducible promoters

  • Construct reporter fusions (gsiC-GFP/LUX) to monitor expression patterns

2. Stress Response Analysis:
The following factorial experimental design allows systematic evaluation of stress responses:

StrainGrowth PhaseStress ConditionGlutathione LevelMeasurement
WTExponentialControlNormalViability
ΔgsiCExponentialControlNormalViability
cpgsiCExponentialControlNormalViability
WTStationaryControlNormalViability
ΔgsiCStationaryControlNormalViability
cpgsiCStationaryControlNormalViability
WTExponentialOxidativeNormalViability
ΔgsiCExponentialOxidativeNormalViability
cpgsiCExponentialOxidativeNormalViability

This pattern continues for all combinations of strains, growth phases, stress conditions (including desiccation, osmotic, and pH stress), glutathione levels (normal, supplemented, depleted), and measurements (viability, growth rate, gene expression, etc.) .

3. Molecular Analysis Techniques:

  • Glutathione transport assays: Measure intracellular glutathione content using HPLC or colorimetric assays before and after exposure to stressors

  • Gene expression analysis: Employ qRT-PCR to quantify transcription levels of gsiC and related genes under various conditions

  • Proteomics: Conduct differential proteome analysis between wild-type and ΔgsiC strains under stress

  • Metabolomics: Analyze changes in metabolite profiles, particularly those related to oxidative stress response

4. Desiccation Tolerance Assessment:
Based on findings from related systems, desiccation tolerance can be specifically evaluated through:

  • Monitoring survival during prolonged drying periods (e.g., 6-day assay)

  • Comparing inactivation rates between wild-type, mutant, and complemented strains

  • Assessing the protective effect of exogenous glutathione supplementation

  • Measuring changes in intracellular glutathione content before and after desiccation

What analytical techniques are most effective for studying gsiC-mediated glutathione transport?

Studying gsiC-mediated glutathione transport requires specialized analytical techniques that can accurately measure transport kinetics, substrate specificity, and the functional consequences of transport activity. The following methodologies are particularly effective:

1. Direct Transport Measurement Techniques:

  • Radiolabeled glutathione uptake assays:

    • Use 35S-labeled glutathione to directly track transport

    • Compare uptake rates between wild-type, ΔgsiC, and complemented strains

    • Perform time-course measurements to determine transport kinetics (Km and Vmax)

    • Assess competition with non-labeled glutathione and structural analogs

  • Fluorescent glutathione derivative tracking:

    • Employ fluorescent glutathione conjugates (e.g., monochlorobimane-glutathione)

    • Monitor intracellular accumulation using fluorescence microscopy or flow cytometry

    • Analyze transport in real-time in living cells

2. Quantification of Intracellular Glutathione:

  • HPLC analysis:

    • Extract and derivatize cellular glutathione

    • Separate and quantify reduced (GSH) and oxidized (GSSG) forms

    • Compare levels between strains with and without functional gsiC

    • Analyze changes after exposure to different glutathione concentrations in medium

  • Enzymatic recycling assay:

    • Use Ellman's reagent (DTNB) coupled with glutathione reductase

    • Measure absorbance changes at 412 nm to quantify glutathione

    • High sensitivity for detecting physiologically relevant changes

3. Membrane Vesicle Transport Studies:

  • Preparation of inside-out membrane vesicles:

    • Isolate bacterial membranes containing gsiC

    • Form sealed vesicles with cytoplasmic side exposed

    • Add ATP and monitor glutathione accumulation

    • Determine the energetics of transport (ATP dependence)

4. Reconstitution in Artificial Systems:

  • Proteoliposome reconstitution:

    • Purify gsiC (with other GsiABCD components if needed)

    • Reconstitute into liposomes of defined composition

    • Measure transport in a controlled environment

    • Test effects of membrane composition on transport efficiency

5. Physiological Impact Analysis:

  • Redox state assessment:

    • Measure intracellular redox potential using redox-sensitive GFP variants

    • Compare oxidative stress markers (protein carbonylation, lipid peroxidation)

    • Analyze expression of redox-responsive genes via qRT-PCR

  • Stress survival correlation:

    • Expose cells to oxidative stress agents (H2O2, paraquat)

    • Determine survival rates and recovery times

    • Correlate with glutathione transport capacity

Research on related systems has shown that intracellular glutathione content measurements are particularly informative, as they directly correlate with stress tolerance phenotypes. For example, in C. sakazakii, the intracellular glutathione content of wild-type strains increased with increasing exogenous glutathione, while gsiD deletion mutants showed significantly lower intracellular glutathione levels regardless of exogenous supplementation .

How does gsiC expression integrate with other cellular regulatory networks?

The expression and function of gsiC in Erwinia carotovora likely integrates with multiple regulatory networks that coordinate bacterial responses to environmental conditions. While specific data on gsiC regulation is limited, insights can be drawn from related systems and the broader regulatory context in this bacterium.

Integration with Rsm Regulatory System:
In E. carotovora, the Rsm (regulator of secondary metabolism) system plays a central role in controlling various cellular processes. Research has shown that:

  • The RNA-binding protein RsmA and the regulatory RNA rsmB regulate the production of extracellular enzymes and virulence factors

  • RsmC activates RsmA production and represses rsmB transcription, extracellular enzyme production, and virulence

  • This regulatory circuit affects multiple physiological processes and pathogenicity

Given the importance of glutathione in bacterial stress responses and metabolism, gsiC expression likely interfaces with this regulatory network, potentially through:

  • Direct regulation by RsmA, which could bind to gsiC mRNA to affect its translation

  • Indirect regulation through other components of stress response pathways

  • Coordinated expression with other stress-responsive genes

Stress-Response Regulation:
The function of glutathione transport becomes particularly important under stress conditions. Several regulatory mechanisms may control gsiC expression in response to stress:

  • Oxidative stress responsive regulators:

    • OxyR and SoxRS may activate gsiC expression under oxidative stress

    • These regulators typically respond to peroxide and superoxide stress, respectively

  • General stress response regulators:

    • RpoS (σ38) likely increases gsiC expression during stationary phase and under various stresses

    • The stringent response (mediated by (p)ppGpp) may modulate expression during nutrient limitation

  • Quorum sensing systems:

    • In E. carotovora, N-(3-oxohexanoyl)-L-homoserine lactone mediates quorum sensing

    • This system may coordinate gsiC expression with population density and virulence factor production

Environmental Sensing and Adaptation:
Environmental factors likely influence gsiC expression through specialized sensing systems:

  • Two-component systems:

    • These sensor-regulator pairs respond to specific environmental cues

    • They may link glutathione transport to broader adaptation strategies

  • Nutrient availability sensing:

    • Expression may be coupled to sulfur metabolic pathways

    • Cysteine availability might influence glutathione transport regulation

A comprehensive understanding of these regulatory interactions requires experimental verification through techniques such as:

  • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

  • Reporter gene assays to monitor promoter activity under various conditions

  • Transcriptomic analysis to identify co-regulated genes

  • Protein-protein interaction studies to map regulatory networks

How can contradictory experimental results regarding gsiC function be reconciled in research?

When researchers encounter contradictory results regarding gsiC function, a systematic approach to reconciliation is essential for advancing understanding. Contradictions may arise from differences in experimental conditions, genetic backgrounds, or technical approaches. The following methodological framework can help resolve such discrepancies:

1. Systematic Variance Analysis:

Implement a full factorial experimental design to identify interaction effects that may explain contradictory results. Key variables to consider include:

Variable CategorySpecific Factors to Control
Bacterial StrainGenetic background, mutation history, plasmid content
Growth ConditionsMedium composition, temperature, pH, aeration, growth phase
Stress ApplicationType, intensity, duration, application method
Measurement MethodsAssay type, detection limit, time point, sample preparation

By systematically varying these factors, researchers can identify conditions under which apparently contradictory results emerge and determine the underlying causes .

2. Technical Validation Approaches:

  • Multiple independent methods: Verify key findings using orthogonal techniques (e.g., both radioactive and fluorescent transport assays)

  • Controls for strain variation: Use multiple reference strains and ensure genetic stability

  • Standardized protocols: Develop detailed protocols that minimize technical variation

  • Blinded analysis: Conduct critical measurements with experimenters blinded to sample identity

3. Molecular Genetic Strategies:

  • Clean genetic manipulations: Create markerless deletion mutants to avoid polar effects

  • Complementation analysis: Test multiple complementation constructs with varying expression levels

  • Domain-specific mutations: Create point mutations affecting specific protein functions rather than complete deletions

  • Suppressor screens: Identify genetic modifiers that may explain strain-specific differences

4. Integrative Data Analysis:

  • Meta-analysis techniques: Systematically compare results across studies with attention to methodological differences

  • Bayesian approaches: Incorporate prior knowledge and uncertainty quantification

  • Systems biology modeling: Develop mathematical models incorporating known interactions to predict conditions leading to different outcomes

5. Common Sources of Contradiction and Resolution Strategies:

Contradiction SourceResolution Approach
Polar effects of mutationsCreate in-frame deletions and complement with native promoter constructs
Growth phase differencesStandardize sampling by cellular parameters rather than time
Medium composition effectsTest minimal vs. rich media and identify specific components causing variation
Genetic compensationPerform acute protein depletion rather than genetic deletion
Technical artifactsImplement multiple controls and validate with independent techniques

By applying these approaches, researchers can transform contradictory results into opportunities for deeper understanding of context-dependent protein function. For example, if gsiC appears essential under some conditions but dispensable in others, this may reveal important insights about conditional redundancy in glutathione transport systems or about the varying importance of glutathione under different environmental stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.