Recombinant Erwinia carotovora subsp. atroseptica Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Metabolism

plsY catalyzes the formation of lysophosphatidic acid (LysoPA) by acylating the sn-1 position of G3P . This reaction initiates the Kennedy pathway for glycerolipid synthesis, essential for:

  • Membrane biogenesis

  • Energy storage (triacylglycerol synthesis)

  • Pathogen-host interactions (indirectly via lipid-dependent virulence)

While Erwinia carotovora primarily employs plant cell wall-degrading enzymes (PCWDE) and the evf virulence factor for host infection, lipid metabolism enzymes like plsY likely support structural integrity and stress adaptation .

Production and Purification

Recombinant plsY is commercially available with the following specifications :

ParameterSpecification
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (short-term); -80°C (long-term)
Purity>90% (SDS-PAGE verified)
ApplicationsEnzyme kinetics studies, structural biology, lipid metabolism assays

Repeated freeze-thaw cycles are discouraged to maintain stability .

Comparative Analysis with GPAT Homologs

plsY shares functional parallels with glycerol-3-phosphate acyltransferases (GPATs) across species:

OrganismKey FeatureReference
Homo sapiensMitochondrial GPAT1 structure resolved via cryo-EM (3.67 Å); CoA-dependent
ArabidopsisBifunctional GPATs with sn-2 acylation and phosphatase activity for cutin
ErwiniaProkaryotic plsY lacks phosphatase activity, prioritizing sn-1 acylation

This contrast highlights evolutionary divergence in lipid biosynthesis strategies.

Research Significance and Applications

  • Biotechnological Utility: plsY serves as a model for studying prokaryotic lipid metabolism and enzyme engineering .

  • Pathogenicity Insights: While not directly a virulence factor, plsY’s role in membrane synthesis may influence bacterial survival in host environments .

  • Industrial Relevance: Potential applications in biofuel production via lipid pathway manipulation .

Limitations and Future Directions

Current data gaps include:

  • Crystal structure of plsY (compared to human GPAT1 ).

  • Direct evidence linking plsY to Erwinia’s pathogenicity.
    Further studies could explore its regulatory interplay with quorum sensing systems or industrial-scale optimization.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing the order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference point for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will select the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
plsY; ECA3591; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
plsY
Target Protein Sequence
MSVTALGMMLIAYLCGSVSSAILFCKITGLPDPRLHGSGNPGATNVLRIGGKAAAATVLV FDILKGMLPVWGAYALGVTPLYLGLTAIAACLGHIYPVFFHFRGGKGVATALGAIAPIGL DLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDN IQRLWRGQESKIWDKLRKKKQPEDEDTSPEE
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It specifically utilizes acyl-phosphate as the fatty acyl donor, and does not accept acyl-CoA or acyl-ACP.
Database Links

KEGG: eca:ECA3591

STRING: 218491.ECA3591

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia carotovora subsp. atroseptica Glycerol-3-phosphate acyltransferase (plsY) and why is it significant in research?

Glycerol-3-phosphate acyltransferase (plsY) is a membrane-bound enzyme that catalyzes the first step in phospholipid biosynthesis in bacteria. In Erwinia carotovora subsp. atroseptica (now also known as Pectobacterium atrosepticum), plsY transfers an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA). This reaction is critical for bacterial membrane formation and integrity. The enzyme is encoded by the plsY gene (locus name ECA3591) and has been assigned the UniProt accession number Q6D157 .

Research significance stems from plsY's essential role in bacterial survival and potential as an antimicrobial target. As a key enzyme in phospholipid biosynthesis, understanding plsY structure and function provides insights into bacterial membrane formation, which impacts pathogenicity, environmental adaptation, and response to antibiotics. This makes recombinant plsY a valuable tool for both fundamental bacterial physiology studies and applied antimicrobial research.

How does plsY function in the bacterial phospholipid synthesis pathway?

In the bacterial phospholipid synthesis pathway, plsY operates at a critical branch point of lipid metabolism. The enzyme specifically catalyzes the reaction:

Acyl-phosphate + Glycerol-3-phosphate → Lysophosphatidic acid + Inorganic phosphate

This acylation reaction represents the committed step in phospholipid biosynthesis, where:

  • Glycerol-3-phosphate is derived from glycolysis or glycerol metabolism

  • Acyl-phosphate donors typically originate from fatty acid synthesis pathways

  • The resulting lysophosphatidic acid serves as the foundation for all glycerophospholipids

The reaction mechanism involves substrate binding, nucleophilic attack by the hydroxyl group of glycerol-3-phosphate on the carbonyl carbon of the acyl-phosphate, and release of inorganic phosphate. This creates the first acyl linkage in what will become a complete phospholipid molecule. The plsY enzyme shows specificity for the sn-1 position of glycerol-3-phosphate, leaving the sn-2 position available for subsequent acylation by other acyltransferases like plsC.

What are the optimal conditions for storing and handling recombinant E. carotovora plsY?

Optimal storage and handling of recombinant E. carotovora plsY requires specific conditions to maintain enzyme stability and activity. Based on manufacturer recommendations for the recombinant protein:

Storage Conditions:

  • Long-term storage: -20°C to -80°C in a Tris-based buffer containing 50% glycerol

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this can significantly reduce enzymatic activity

Handling Recommendations:

  • Thaw frozen aliquots rapidly at room temperature followed by immediate transfer to ice

  • Prepare working aliquots during the first thaw to minimize protein degradation

  • Use protein-low-binding microcentrifuge tubes for dilutions and reactions

  • Maintain sample temperature between 0-4°C during experimental setup

  • Include protease inhibitors when working with crude preparations

  • Consider the addition of reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of critical cysteine residues

For experiments requiring extended handling times, a temperature-controlled environment and the addition of stabilizing agents like BSA (0.1-1 mg/ml) can help maintain enzyme activity.

What experimental methods are recommended for assessing plsY enzymatic activity?

Several complementary approaches can be employed to assess plsY enzymatic activity in research settings:

Radiochemical Assay:

  • Principle: Measures incorporation of radiolabeled substrates into lysophosphatidic acid

  • Method: Incubate enzyme with [14C]-glycerol-3-phosphate and acyl-phosphate donors

  • Detection: Extract lipids using organic solvents, separate by TLC, and quantify by scintillation counting

  • Advantage: High sensitivity for detecting even low enzymatic activity

Coupled Enzymatic Assay:

  • Principle: Links inorganic phosphate release to a colorimetric or fluorometric detection system

  • Method: Combine plsY reaction with enzymatic reactions that consume Pi and produce a detectable signal

  • Detection: Spectrophotometric measurement of reaction products

  • Advantage: Continuous monitoring of reaction kinetics in real-time

Mass Spectrometry:

  • Principle: Direct detection of reaction products and substrates

  • Method: Incubate enzyme with substrates, quench reaction, and analyze by LC-MS/MS

  • Detection: Quantification of lysophosphatidic acid formation

  • Advantage: High specificity and ability to identify multiple lipid species simultaneously

Recommended Experimental Controls:

  • Heat-inactivated enzyme (negative control)

  • Known acyltransferase inhibitors (negative control)

  • Purified acyltransferase with established activity (positive control)

  • Substrate-only incubations to account for non-enzymatic acyl transfer

For optimal results, reactions should be conducted at physiologically relevant pH (7.0-7.5) with appropriate ionic strength (100-150 mM) and divalent cations (typically 5-10 mM Mg2+).

How can researchers overcome solubility challenges when working with recombinant plsY?

As a membrane-associated enzyme, recombinant plsY presents significant solubility challenges that require specialized approaches:

Detergent-Based Solubilization:

  • Mild non-ionic detergents (0.5-1% Triton X-100, DDM, or CHAPS) can solubilize plsY while maintaining activity

  • Critical micelle concentration (CMC) must be maintained throughout purification and assays

  • Gradual detergent removal using dialysis or detergent-absorbing beads can improve protein stability

Liposome Reconstitution:

  • Incorporation into phospholipid liposomes of defined composition creates a native-like membrane environment

  • Method: Mix purified plsY with phospholipids, remove detergent, and form proteoliposomes

  • Advantage: Preserves native conformation and potentially higher enzymatic activity

Fusion Partners and Solubility Tags:

  • Expression with solubility-enhancing fusion partners (MBP, SUMO, TRX) can improve protein production

  • Cleavable tags allow removal after solubilization if necessary for activity studies

  • Consideration must be given to tag positioning to avoid interference with catalytic sites

Nanodiscs Technology:

  • Embedding plsY in nanodiscs provides a defined membrane environment with improved stability

  • Composition can be tailored to mimic bacterial membranes

  • Improves compatibility with structural and biophysical characterization techniques

Practical Protocol:

  • Express recombinant plsY with an N-terminal solubility tag

  • Purify using affinity chromatography in the presence of appropriate detergent

  • Verify protein folding using circular dichroism before functional studies

  • For long-term storage, maintain in 50% glycerol with detergent concentrations above CMC

These approaches can be optimized based on the specific experimental goals, from structural studies to enzymatic characterizations.

How does E. carotovora subsp. atroseptica plsY compare structurally to orthologs in other bacteria?

Comparative analysis of plsY across bacterial species reveals conserved features alongside species-specific adaptations:

Sequence Conservation:
E. carotovora subsp. atroseptica plsY shares significant sequence homology with other bacterial orthologs, particularly in catalytic regions. Key sequence features include:

  • Highly conserved acyltransferase domain with characteristic HX4D motif

  • Transmembrane helices with greater sequence divergence but conserved hydrophobicity profiles

  • Substrate-binding regions showing higher conservation than peripheral structural elements

Structural Comparison Table:

SpeciesSequence Identity to E. carotovora plsYKey Structural DifferencesSpecialized Features
E. coli~68%Extended C-terminal regionAdditional regulatory sites
P. aeruginosa~60%Altered substrate binding pocketAccommodates more diverse acyl chains
B. subtilis~42%Different membrane-association domainsAdapted to Gram-positive cell envelope
S. aureus~38%Unique active site topologyTarget for antimicrobial development

Phylogenetic Relationships:
Phylogenetic analysis places E. carotovora subsp. atroseptica plsY in close evolutionary relationship with other Enterobacteriaceae enzymes, while showing greater divergence from Gram-positive bacterial orthologs. These relationships reflect both vertical inheritance patterns and potential horizontal gene transfer events that have shaped plsY evolution.

The structural conservation of catalytic domains across diverse bacterial species highlights the essential nature of plsY function in bacterial phospholipid biosynthesis, while variations in substrate specificity regions may reflect adaptation to different membrane compositions or environmental niches.

What regulatory mechanisms control plsY expression in Erwinia species?

While specific information about plsY regulation in E. carotovora is limited in the provided search results, insights can be drawn from related regulatory mechanisms in Erwinia species:

Transcriptional Regulation:
In Erwinia species, gene expression is often controlled by multiple regulatory proteins. For enzymes involved in metabolic pathways, these typically include:

  • KdgR - A negative regulator that has been identified in both E. carotovora subsp. carotovora and E. chrysanthemi with highly conserved DNA-binding motifs (helix-turn-helix domains)

  • CRP (cAMP Receptor Protein) - A global regulator responding to carbon source availability, with homologues present in E. carotovora subsp. carotovora showing high amino acid identity to those in other Erwinia species

Post-Transcriptional Regulation:
RNA-based regulation likely plays a role in controlling plsY expression, potentially involving:

  • Small non-coding RNAs that regulate mRNA stability or translation

  • Riboswitches that sense metabolite concentrations and alter RNA structure

  • RNA-binding proteins that modulate translation efficiency

Metabolic Regulation:
As plsY functions at a critical branch point in lipid metabolism, its activity is likely regulated by:

  • Feedback inhibition by downstream products

  • Substrate availability, particularly acyl-phosphate donors

  • Membrane composition and fluidity sensing mechanisms

The comparative study by Matsumoto et al. showed that regulatory proteins in Erwinia species often have conserved functions even when sequence conservation is moderate, suggesting that similar mechanisms might control plsY expression across different Erwinia subspecies . The binding of regulatory proteins to promoter regions shows specificity patterns that differ between species, potentially explaining subspecies-specific expression patterns.

How does E. carotovora subsp. atroseptica plsY function in the context of bacterial pathogenicity?

The role of plsY in E. carotovora subsp. atroseptica pathogenicity represents an important research area connecting membrane phospholipid synthesis to virulence mechanisms:

Membrane Integrity and Stress Response:
plsY activity directly impacts membrane phospholipid composition, which affects:

  • Membrane fluidity and adaptation to environmental stresses during host infection

  • Resistance to host defense mechanisms, including antimicrobial peptides

  • Formation of outer membrane vesicles (OMVs) that can deliver virulence factors

Virulence Factor Production and Secretion:
While not directly involved in virulence factor synthesis, plsY may indirectly influence pathogenicity by:

  • Supporting membrane structures required for secretion systems (Type I-VI)

  • Contributing to lipid microdomains that serve as platforms for virulence factor assembly

  • Maintaining energized membranes necessary for virulence factor export

Regulatory Connections:
In soft-rot Erwinia species like E. carotovora, virulence mechanisms are regulated by complex networks that may intersect with plsY expression. From the comparative study results, we know that several regulatory systems control enzyme production in these bacteria:

  • KdgR functions as a major repressor in both E. carotovora and E. chrysanthemi

  • CRP influences gene expression in response to carbon source availability

  • Other regulators like HexA, GacA/GacS, and RsmA influence virulence factor production

These regulatory connections suggest that plsY expression and activity may be coordinated with virulence mechanisms through shared regulatory networks, allowing the bacterium to adapt its membrane composition during different stages of infection.

How can structural studies of plsY inform antimicrobial drug development?

Structural characterization of plsY offers significant potential for antimicrobial drug development through several research approaches:

Structure-Based Drug Design:
The essential nature of plsY in bacterial phospholipid biosynthesis makes it an attractive antimicrobial target. Detailed structural analysis can reveal:

  • Catalytic site architecture for designing competitive inhibitors

  • Allosteric binding pockets for developing non-competitive inhibitors

  • Species-specific structural features that could enable selective targeting

Critical Structural Elements for Inhibitor Design:

Structural FeatureDrug Development PotentialExpected Antimicrobial Effects
Acyl-phosphate binding pocketHigh-affinity competitive inhibitorsDisruption of phospholipid synthesis
Glycerol-3-phosphate siteTransition-state mimeticsMembrane integrity compromise
Transmembrane helicesMembrane-disruptive peptidesEnzyme displacement from membrane
Protein-protein interaction interfacesOligomerization inhibitorsFunctional inactivation

Experimental Approaches:
Advanced structural biology techniques that can support this research include:

  • X-ray crystallography of solubilized plsY to obtain atomic-resolution structures

  • Cryo-electron microscopy to visualize membrane-embedded conformations

  • NMR spectroscopy for analyzing dynamics and ligand interactions

  • Molecular dynamics simulations to identify transient binding pockets

Translational Research Pathway:
Moving from structural insights to antimicrobial candidates requires:

  • Virtual screening of compound libraries against identified binding sites

  • Fragment-based approaches to develop high-affinity lead compounds

  • Structure-activity relationship studies to optimize potency and specificity

  • Whole-cell assays to confirm membrane penetration and target engagement

The unique bacterial origin of plsY with no direct human homolog makes it particularly valuable for developing antibiotics with potentially low host toxicity, addressing a critical need in the face of increasing antimicrobial resistance.

What techniques can be used to study the integration of plsY function with other metabolic pathways?

Investigating the integration of plsY with broader metabolic networks requires sophisticated systems biology approaches:

Metabolic Flux Analysis:
Isotope labeling experiments can trace the flow of metabolites through plsY-catalyzed reactions and connected pathways:

  • 13C-labeled glycerol feeding to track incorporation into phospholipids

  • Quantitative mass spectrometry to measure isotopomer distributions

  • Computational modeling to determine flux control coefficients

  • Comparison of flux patterns under different growth conditions or genetic backgrounds

Multi-omics Integration:
Combining multiple data types offers comprehensive insights into plsY's metabolic integration:

  • Transcriptomics to identify co-regulated genes under various conditions

  • Proteomics to determine enzyme abundance and post-translational modifications

  • Lipidomics to characterize membrane composition changes

  • Metabolomics to identify pathway intermediates and potential regulatory metabolites

Protein-Protein Interaction Studies:
Identifying physical interactions between plsY and other proteins reveals functional relationships:

  • Bacterial two-hybrid screening to identify interaction partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling approaches in living cells

  • Fluorescence resonance energy transfer (FRET) to confirm interactions in vivo

Genetic Interaction Mapping:
Synthetic genetic arrays or CRISPR interference screens can reveal functional relationships:

  • Identification of synthetic lethal or synthetic rescue interactions

  • Construction of double mutants to assess epistatic relationships

  • Dose-dependent genetic interactions using tunable expression systems

  • Comparison of interaction networks across different bacterial species

These complementary approaches can reveal how plsY function is coordinated with fatty acid synthesis, glycerolipid metabolism, cell envelope biogenesis, and stress response pathways, providing a systems-level understanding of bacterial lipid metabolism.

How might genetic modification of plsY be used to engineer bacterial membrane properties?

Genetic engineering of plsY offers promising avenues for rationally modifying bacterial membrane properties with applications in biotechnology and synthetic biology:

Structure-Function Guided Modifications:
Targeted mutations in plsY can alter enzyme properties in predictable ways:

  • Active site modifications to alter substrate specificity for incorporation of non-natural acyl chains

  • Regulatory domain mutations to decouple enzyme activity from normal cellular controls

  • Stability-enhancing mutations to improve function under extreme conditions

  • Fusion to other domains to create bifunctional enzymes with novel activities

Membrane Engineering Applications:

Engineering GoalplsY Modification ApproachPotential Applications
Cold toleranceAlter substrate specificity for unsaturated fatty acidsPsychrophilic bioprocessing
Solvent resistanceEnhance binding of branched-chain acyl donorsBiofuel production
Altered permeabilityModify headgroup compatibilityDrug delivery systems
Biofilm propertiesRegulate phospholipid compositionControlled surface attachment

Experimental Design Strategies:
Successful engineering of plsY requires systematic approaches:

  • Direct evolution with selection for desired membrane properties

  • Rational design based on comparative analysis across extremophilic bacteria

  • Domain swapping between plsY orthologs with different properties

  • Construction of feedback-resistant variants to override normal regulation

Synthetic Biology Integration:
In synthetic biology applications, engineered plsY variants can be incorporated into:

  • Genetic circuits that dynamically adjust membrane composition in response to environmental cues

  • Minimal cell designs with simplified membrane biosynthesis pathways

  • Orthogonal systems for producing membrane domains with specialized functions

  • Cell-free systems for generating tailored liposomes or nanodiscs

These engineering approaches could enable the development of bacterial strains with customized membrane properties for applications ranging from bioremediation in extreme environments to improved heterologous protein expression systems and novel biocatalysts.

What strategies can resolve issues with recombinant plsY expression and purification?

Researchers frequently encounter challenges when working with recombinant plsY due to its membrane-associated nature. Several targeted approaches can address common problems:

Low Expression Yields:

  • Optimize codon usage for the expression host to improve translation efficiency

  • Test multiple promoter systems (T7, tac, araBAD) to identify optimal expression conditions

  • Employ specialized E. coli strains designed for membrane protein expression (C41, C43, Lemo21)

  • Reduce expression temperature (16-20°C) and inducer concentration to slow protein production

Inclusion Body Formation:

  • Incorporate solubility-enhancing fusion partners (MBP, SUMO, TrxA) at the N-terminus

  • Add osmolytes (sorbitol, betaine) to the growth medium to promote proper folding

  • Include chemical chaperones (glycerol, trimethylamine N-oxide) in the expression medium

  • Develop refolding protocols from solubilized inclusion bodies using appropriate detergents

Purification Challenges:

  • Optimize detergent selection and concentration for efficient solubilization

  • Implement two-phase extraction systems for preliminary enrichment

  • Utilize cobalt-based IMAC resins instead of nickel for cleaner purification of His-tagged proteins

  • Incorporate size exclusion chromatography as a final purification step to remove aggregates

Activity Loss During Purification:

  • Maintain constant detergent concentration above CMC throughout all purification steps

  • Include phospholipids (0.1-0.5 mg/ml) in purification buffers to stabilize native conformation

  • Add glycerol (10-20%) and reducing agents to prevent oxidative damage

  • Minimize purification duration and maintain low temperature (4°C) throughout

Practical Workflow:

  • Screen multiple constructs with different tags in parallel

  • Implement small-scale expression trials before scaling up

  • Develop a rapid screening method to assess folding and activity in crude extracts

  • Optimize each purification step individually before combining into a complete protocol

These strategies can significantly improve success rates when working with this challenging but important enzyme.

How can researchers address data inconsistencies in plsY functional assays?

When conducting functional assays with plsY, researchers may encounter inconsistent results. Systematic troubleshooting approaches can help identify and resolve common sources of variability:

Enzyme Activity Variability:

  • Establish rigorous protein quality control metrics before functional assays

  • Develop a specific activity benchmark using a standardized substrate and condition set

  • Implement batch tracking and consistency testing across protein preparations

  • Consider developing an internal standard or reference preparation for normalization

Substrate-Related Inconsistencies:

  • Verify substrate purity using analytical methods (TLC, HPLC) before assays

  • Prepare fresh acyl-phosphate substrates immediately before use due to hydrolytic instability

  • Standardize substrate preparation methods, particularly for hydrophobic components

  • Test substrate solubility in reaction buffers to ensure consistent availability

Assay Condition Optimization:

  • Conduct systematic buffer optimization (pH, ionic strength, divalent cations)

  • Determine the linear range of the assay with respect to enzyme concentration and reaction time

  • Identify potential interfering compounds in your specific assay system

  • Establish appropriate positive and negative controls for each experiment

Data Analysis Standardization:

  • Implement consistent data processing workflows, ideally automated when possible

  • Determine appropriate statistical methods for your specific assay type

  • Establish clear criteria for identifying and handling outliers

  • Consider blinded analysis when comparing different conditions or treatments

Troubleshooting Decision Tree:

  • If activity varies between batches:

    • Compare protein purity by SDS-PAGE

    • Verify protein folding by circular dichroism

    • Assess aggregation state by size exclusion chromatography

  • If activity decreases during experiments:

    • Test enzyme stability at assay temperature

    • Evaluate potential product inhibition

    • Check for interfering compounds in reaction components

  • If results conflict with literature values:

    • Verify buffer composition and pH measurement accuracy

    • Confirm substrate identity and concentration calculation

    • Compare detailed methodology for subtle procedural differences

By systematically addressing these potential sources of variability, researchers can develop robust and reproducible assays for studying plsY function.

What considerations are important when interpreting evolutionary analyses of plsY across bacterial species?

Evolutionary analyses of plsY across bacterial species require careful interpretation to avoid common pitfalls and extract meaningful biological insights:

Sequence Sampling Considerations:

  • Ensure adequate taxonomic representation to avoid phylogenetic bias

  • Include sufficient outgroups for proper tree rooting

  • Consider horizontal gene transfer events that may confound vertical inheritance patterns

  • Evaluate the impact of environmental niche and lifestyle on selection pressures

Alignment Quality Assessment:

  • Pay special attention to transmembrane regions, which may align poorly due to sequence divergence

  • Distinguish between conservation of amino acid identity versus physicochemical properties

  • Consider structural information when evaluating the significance of conserved residues

  • Use appropriate alignment algorithms for membrane proteins (e.g., PRALINE-TM, TM-Coffee)

Selection Analysis Interpretation:

  • Differentiate between purifying selection (conservation) and positive selection (adaptation)

  • Analyze different functional domains separately as they may experience different selection pressures

  • Consider the impact of bacterial growth conditions on evolutionary constraints

  • Evaluate coevolution between plsY and interacting proteins or substrates

Comparative Genomic Context:

  • Analyze gene neighborhood conservation to identify functionally related genes

  • Evaluate operon structure variation across species

  • Consider genome reduction events in obligate pathogens or symbionts

  • Assess correlation between plsY sequence features and bacterial membrane composition

Common Interpretation Pitfalls:

Analytical ChallengePotential MisinterpretationRecommended Approach
Long-branch attractionIncorrect phylogenetic placementUse model-based phylogenetic methods
Sequence saturationUnderestimation of evolutionary distanceApply appropriate substitution models
Functional convergenceMisidentification of homologyCombine sequence and structural analysis
Lineage-specific rate variationIncorrect inference of selectionEmploy branch-specific evolutionary models

When interpreting comparative analyses between E. carotovora and other bacterial species, consider that regulatory patterns may differ significantly even when protein sequences show high conservation. For example, the study by Matsumoto et al. demonstrated that homologous regulatory proteins can function differently across Erwinia species despite structural similarities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.