Recombinant Erwinia carotovora subsp. atroseptica Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MsbA belongs to the ATP-binding cassette (ABC) transporter superfamily, conserved across prokaryotes and eukaryotes. In E. carotovora, it facilitates the flipping of lipid A—a key component of lipopolysaccharides (LPS)—from the inner to the outer membrane leaflet, a process vital for bacterial viability . The recombinant form (UniProt ID: Q6D437) retains full-length functionality (1–582 amino acids) and is purified to >90% purity via SDS-PAGE .

Conformational Dynamics

MsbA undergoes large-scale conformational changes during its transport cycle:

  • Inward-facing state: Cytoplasmic chamber accessible, nucleotide-binding domains (NBDs) disengaged .

  • Outward-facing state: ATP binding induces NBD dimerization, reorienting transmembrane helices to extrude lipid A .

Crystal structures (e.g., PDB ID: 3B5W) reveal a flexible hinge mechanism in extracellular loops 2 and 3, enabling alternating access to substrate-binding chambers . Mutations like E506Q and H537A in the NBDs impair ATP hydrolysis while preserving ATP binding, locking MsbA in a closed dimer conformation .

ATPase Activity

  • Wild-type MsbA: Hydrolyzes ATP with a turnover rate critical for lipid A flipping .

  • Dysfunctional mutants: E506Q and H537A reduce hydrolysis by >90%, confirmed via ATPase assays and electron paramagnetic resonance (EPR) spectroscopy .

Mechanistic Studies

  • EPR spectroscopy: Tracks spin-labeled residues to map conformational shifts during ATP hydrolysis .

  • X-ray crystallography: Resolves nucleotide-bound (e.g., AMP-PNP) and apo states, elucidating transport cycles .

Antibiotic Development

As lipid A transport is essential for Gram-negative bacterial survival, MsbA is a promising target for novel antibiotics. Inhibitors disrupting its ATPase activity or substrate binding could combat multidrug-resistant pathogens .

Critical Residues and Motifs

  • Walker A/B motifs: Mediate ATP binding and hydrolysis .

  • LSGGQ (C-loop): Stabilizes ATP via interactions with the opposing NBD .

  • H537 and E506: Form a catalytic dyad; mutations here abolish viability in E. coli complementation assays .

Mutant Phenotypes

MutationATP BindingHydrolysisConformation
E506QPreserved<10%Closed dimer (DEER)
H537APreserved<5%Closed dimer (DEER)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; ECA2557; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
msbA
Target Protein Sequence
MLNDKDLSTWQTFRRLWPMISPFKAGLAVAAIALIINAAGDTLMLSLLKPLLDEGFGKAD RSVLLWMPLVVIGLMLVRGASGFVSSYCVSWVSGKVVMNMRRRLFSHIMGMPVAFFDQQS TGTLLSRITYDSEQVAASSSGALITVVREGASIIGLFILMFYYSWQLSIILIVIAPIVSI AMRMVSKRFRSISKNMQDTMGHVTTSTEQMLKGHKEVLMFGGQDVETKRFEQVSNRMRQQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMETLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDMEQERDTGKREIERAKGELEFRQVNFAYPARENLALK NINLHIPVGKTVALVGRSGSGKSTIASLITRFYDIQSGEILLDGHDLREYRLSSLRNQVA LVSQNVHLFNDTIANNIAYARNENYSREEIERAAKMAYAMDFINKMEHGLDTVIGENGVM LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKDRTALVIAHRLS TIEKADEILVVEDGRIIERGNHTALLATNGAYAQLHRMQFGE
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: eca:ECA2557

STRING: 218491.ECA2557

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MsbA in Erwinia carotovora subsp. atroseptica?

MsbA in Erwinia carotovora subsp. atroseptica functions as a Lipid A export ATP-binding/permease protein. It belongs to the ATP-binding cassette (ABC) transporter family and plays a critical role in the export of lipopolysaccharide components across the inner membrane, which is essential for maintaining outer membrane integrity. This transport mechanism is crucial for bacterial survival and pathogenicity, particularly in plant pathogens like Erwinia carotovora that cause soft rot diseases .

How does MsbA compare to homologous proteins in other bacterial species?

MsbA in Erwinia carotovora subsp. atroseptica shares structural and functional similarities with MsbA proteins found in other Gram-negative bacteria, particularly enteric pathogens. While the core ATP-binding and permease domains are conserved across species, subtle sequence variations exist that may influence substrate specificity and transport efficiency. These differences may reflect adaptation to specific host environments and pathogenicity mechanisms. Comparative analysis with homologs from Escherichia coli and other enteric bacteria reveals conservation of key functional domains while maintaining species-specific adaptations in substrate recognition regions.

What expression systems are most effective for producing recombinant MsbA from Erwinia carotovora?

For the expression of recombinant MsbA from Erwinia carotovora subsp. atroseptica, E. coli-based expression systems have been demonstrated to be effective. The recombinant protein can be expressed with an N-terminal His-tag to facilitate purification. The full-length protein (1-582 amino acids) has been successfully expressed in E. coli, which suggests compatibility between the expression machinery of E. coli and the codon usage patterns of the msbA gene from Erwinia carotovora .

What are the optimal conditions for solubilizing and purifying MsbA protein?

As a membrane protein, MsbA requires careful solubilization and purification protocols. After expression in E. coli, the following methodological approach is recommended:

  • Cell Lysis: Mechanical disruption (sonication or French press) in a buffer containing 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, and protease inhibitors.

  • Membrane Fraction Isolation: Differential centrifugation to separate membranes from cytosolic components.

  • Solubilization: Gentle solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration.

  • Affinity Purification: Nickel-nitrilotriacetic acid (Ni-NTA) chromatography utilizing the His-tag, with washing steps containing low imidazole concentrations to remove non-specific binding proteins.

  • Size Exclusion Chromatography: Final purification step to obtain homogeneous protein preparations.

The purified protein can be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and aliquots should be stored at -20°C/-80°C to avoid repeated freeze-thaw cycles .

How can researchers assess the purity and functionality of purified recombinant MsbA?

To assess protein purity and functionality, a multi-faceted approach is recommended:

  • Purity Assessment:

    • SDS-PAGE analysis (>90% purity should be achievable)

    • Western blotting with anti-His antibodies to confirm identity

    • Mass spectrometry for precise molecular weight determination

  • Functionality Assays:

    • ATPase activity measurement using colorimetric phosphate detection

    • Lipid A transport assays using fluorescently labeled substrates

    • Reconstitution into liposomes to assess membrane integration

  • Structural Integrity:

    • Circular dichroism spectroscopy to verify secondary structure elements

    • Limited proteolysis to confirm proper folding

    • Thermal shift assays to evaluate protein stability

These methods collectively provide a comprehensive assessment of both protein quality and functional capacity.

What methods are effective for studying the ATPase activity of recombinant MsbA?

For studying the ATPase activity of recombinant MsbA from Erwinia carotovora subsp. atroseptica, the following methodological approaches are recommended:

MethodPrincipleAdvantagesLimitations
Malachite Green AssayColorimetric detection of released inorganic phosphateHigh sensitivity, simple setupPotential interference from buffer components
Coupled Enzyme AssayADP formation coupled to NADH oxidationReal-time monitoring, continuous dataComplex system with multiple components
Radioactive [γ-32P]ATP HydrolysisDirect measurement of ATP hydrolysisHigh accuracy, direct measurementRequires radioactive handling facilities
ADP-Glo™ AssayLuminescent detection of ADP productionHigh-throughput compatible, sensitiveHigher cost, requires specialized equipment

When conducting these assays, it's critical to include appropriate controls:

  • Detergent-only controls to account for detergent effects on assay components

  • Heat-inactivated protein samples to establish baseline

  • Known ATPase inhibitors to confirm specificity

The ATPase activity should be characterized in terms of:

  • Kinetic parameters (Km, Vmax)

  • pH and temperature optima

  • Divalent cation requirements (typically Mg2+)

  • Substrate specificity

  • Response to potential inhibitors

How does the disulfide bond formation system interact with MsbA function in Erwinia carotovora?

The relationship between the disulfide bond formation system and MsbA function in Erwinia carotovora represents an intriguing area of research. While direct evidence for interaction between DsbA/DsbC proteins and MsbA in Erwinia carotovora is limited, several methodological approaches can be employed to investigate this relationship:

  • Co-immunoprecipitation studies: Using antibodies against MsbA to pull down potential interaction partners, followed by mass spectrometry identification of DsbA/DsbC proteins.

  • Bacterial two-hybrid assays: To detect protein-protein interactions between MsbA and components of the disulfide bond formation system.

  • Phenotypic analysis of double mutants: Creating and characterizing dsbA/msbA or dsbC/msbA double mutants to observe synergistic or antagonistic effects on bacterial physiology.

Research on related bacterial systems suggests a potential functional relationship, as proper disulfide bond formation in the periplasm is critical for the structural integrity of many membrane and secreted proteins. In Erwinia carotovora, defects in periplasmic disulfide bond formation act as signals that are relayed to the transcription machinery, affecting gene expression in diverse ways . This feedback regulation system could potentially impact msbA expression or the stability/function of the MsbA protein itself, particularly if MsbA contains cysteine residues that form structural disulfide bonds.

What is the relationship between MsbA function and virulence in Erwinia carotovora?

The relationship between MsbA function and virulence in Erwinia carotovora can be investigated through several experimental approaches:

  • Generation of msbA knockout or conditional mutants: Using marker exchange mutagenesis similar to the approach used for dsbA genes in Erwinia carotovora . Due to the likely essential nature of MsbA, conditional mutants may be necessary.

  • Plant infection assays: Comparing tissue maceration capabilities of wild-type and msbA-deficient strains in planta. The reduced tissue maceration observed in dsb mutants suggests that membrane protein function is critical for virulence .

  • Enzyme secretion analysis: Measuring the activity and secretion of virulence factors such as pectate lyase, endopolygalacturonase, cellulase, and proteases in wild-type versus msbA-compromised strains.

  • Lipopolysaccharide integrity assessment: Analyzing LPS profiles using silver-stained gels to determine if MsbA dysfunction affects LPS transport and assembly.

  • Transcriptional profiling: Using RNA-seq or microarray analysis to identify changes in gene expression patterns between wild-type and msbA-compromised strains, focusing on virulence-associated genes.

The evidence from studies on dsbA mutants in Erwinia carotovora shows that periplasmic protein function significantly impacts virulence factor secretion and tissue maceration ability . Given MsbA's role in lipid transport and membrane integrity, it likely plays a crucial role in bacterial virulence by maintaining the proper structure of the cell envelope required for secretion systems and resistance to host defense mechanisms.

What advanced methods can be used to determine the structural characteristics of MsbA?

Understanding the structural features of MsbA from Erwinia carotovora subsp. atroseptica requires sophisticated methodological approaches. The following techniques are recommended for comprehensive structural characterization:

When applying these methods to MsbA, special considerations for membrane proteins include:

  • Detergent selection critical for maintaining native structure

  • Lipid nanodiscs or amphipols as alternatives to detergents

  • Potential use of antibody fragments to stabilize specific conformations

  • Careful control of nucleotide binding state (ATP, ADP, transition state analogs)

How do conformational changes in MsbA correlate with its ATP hydrolysis and transport cycle?

The ATP hydrolysis and transport cycle of MsbA involves distinct conformational states that can be investigated using advanced biophysical techniques. A methodological framework for correlating these conformational changes with functional states includes:

  • State-specific structural studies:

    • Structure determination in the presence of different nucleotides (ATP, ADP, non-hydrolyzable ATP analogs)

    • Trapping transition states using vanadate or aluminum fluoride

    • Site-directed mutagenesis of key catalytic residues to stabilize specific conformations

  • Real-time conformational monitoring:

    • Site-specific fluorescent labeling at key domains with environment-sensitive probes

    • Förster resonance energy transfer (FRET) between strategically placed donor-acceptor pairs

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Computational approaches:

    • Molecular dynamics simulations to model the complete transport cycle

    • Principal component analysis to identify major conformational motions

    • Free energy calculations to determine energy barriers between conformational states

Based on studies of homologous ABC transporters, MsbA likely cycles through at least three major conformational states:
a) Inward-facing (nucleotide-free)
b) Occluded (ATP-bound)
c) Outward-facing (pre-hydrolysis)

Each state represents a distinct stage in substrate recognition, binding, and translocation across the membrane.

How has the MsbA protein evolved across different Erwinia species and what are the functional implications?

Investigating the evolutionary trajectory of MsbA across Erwinia species provides valuable insights into its functional adaptation. A systematic approach to this comparative analysis would include:

  • Phylogenetic analysis:

    • Multiple sequence alignment of MsbA sequences from different Erwinia species

    • Construction of phylogenetic trees to establish evolutionary relationships

    • Calculation of selection pressures (dN/dS ratios) to identify regions under positive selection

  • Structural comparison:

    • Homology modeling based on available structures of MsbA homologs

    • Mapping of conserved and variable regions onto the structural model

    • Identification of species-specific structural features that may impact function

  • Functional domain analysis:

    • Comparison of nucleotide-binding domains for conservation of Walker A/B motifs

    • Analysis of transmembrane domain variability that may affect substrate specificity

    • Examination of potential periplasmic loops involved in substrate recognition

The MsbA protein in Erwinia carotovora subsp. atroseptica (now classified as Pectobacterium atrosepticum) represents an adaptation to the specific environmental niche and pathogenic lifestyle of this plant pathogen. Comparative analysis with homologs from related species would reveal how evolutionary pressures have shaped this essential transporter to accommodate species-specific requirements for lipid transport and membrane biogenesis.

What functional differences exist between MsbA and other ATP-binding cassette transporters in Erwinia carotovora?

Distinguishing the functional characteristics of MsbA from other ABC transporters in Erwinia carotovora requires a comprehensive comparative analysis approach:

  • Substrate specificity determination:

    • In vitro transport assays with various labeled lipid substrates

    • Competition assays to identify preferred substrates

    • Structural analysis of substrate-binding pockets

  • Expression pattern analysis:

    • Transcriptomic profiling under various environmental conditions

    • Promoter activity studies using reporter gene fusions

    • Response to stress conditions relevant to the bacterial lifestyle

  • Genetic interaction mapping:

    • Synthetic genetic array analysis to identify genetic interactions

    • Suppressor mutation screening to identify functional relationships

    • Construction of conditional mutants in multiple ABC transporter genes

  • Comparative biochemical characterization:

    • ATPase activity profiles (Km, Vmax, inhibitor sensitivity)

    • Thermostability and pH optima determination

    • Divalent cation requirements and nucleotide preferences

This comparative analysis would help elucidate the specific role of MsbA within the broader context of the ABC transporter family in Erwinia carotovora, highlighting its unique contributions to bacterial physiology and pathogenicity.

How can researchers develop specific inhibitors targeting MsbA for potential antimicrobial applications?

Developing specific inhibitors targeting MsbA from Erwinia carotovora subsp. atroseptica requires a rational drug design approach. The following methodological framework is recommended:

  • Target validation and assay development:

    • Confirmation of MsbA essentiality through conditional knockdown experiments

    • Development of robust high-throughput ATPase activity assays

    • Establishment of whole-cell screening systems using reporter strains

  • Structure-based inhibitor design:

    • Virtual screening against the ATP-binding pocket or substrate-binding regions

    • Fragment-based screening using NMR or X-ray crystallography

    • Molecular docking studies to identify potential binding modes

  • Screening strategies:

    • Natural product libraries enriched for compounds active against plant pathogens

    • Focused chemical libraries based on known ABC transporter inhibitors

    • Peptidomimetic approaches targeting specific protein-protein interactions

  • Lead optimization pipeline:

    PhaseMethodsEndpointsCriteria
    Initial ScreeningATPase inhibition assay% inhibition at 10 μM>50% inhibition
    Dose-ResponseSerial dilution ATPase assayIC50 valuesIC50 <1 μM
    SelectivityTesting against human ABC transportersSelectivity index>10-fold selectivity
    Cellular ActivityGrowth inhibition assaysMIC valuesMIC <10 μg/mL
    Plant ProtectionEx vivo infection modelsDisease reduction>70% protection
  • Resistance potential assessment:

    • Spontaneous resistance frequency determination

    • Whole-genome sequencing of resistant mutants

    • Structure-activity relationship studies to combat resistance

This systematic approach would enable the development of specific MsbA inhibitors that could serve as leads for novel antimicrobial agents against Erwinia carotovora and related plant pathogens.

What are the cutting-edge methods for studying MsbA-lipid interactions in native membrane environments?

Investigating MsbA-lipid interactions in native membrane environments requires sophisticated methodological approaches that preserve the natural lipid context. The following cutting-edge techniques are recommended:

  • Native mass spectrometry:

    • Direct analysis of MsbA-lipid complexes after gentle extraction

    • Identification of specifically bound lipid species

    • Determination of binding stoichiometries and affinities

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping of lipid-protected regions on the protein surface

    • Dynamics of protein-lipid interactions over time

    • Conformational changes induced by specific lipid binding

  • Solid-state NMR spectroscopy:

    • Site-specific interactions between labeled protein residues and lipids

    • Dynamic aspects of lipid-protein interactions

    • Influence of lipid composition on protein structure

  • Cryo-electron tomography:

    • Visualization of MsbA in its native membrane context

    • Spatial organization and potential clustering

    • Structural changes in different functional states

  • Nanoscale secondary ion mass spectrometry (NanoSIMS):

    • Spatial distribution of isotopically labeled lipids around MsbA

    • Preferential association with specific membrane domains

    • Temporal dynamics of lipid organization

  • Advanced fluorescence techniques:

    • Single-molecule fluorescence resonance energy transfer (smFRET)

    • Fluorescence correlation spectroscopy (FCS)

    • Fluorescence recovery after photobleaching (FRAP)

These methods collectively provide a comprehensive view of how MsbA interacts with its lipid environment, which is crucial for understanding its transport mechanism and substrate specificity in the native bacterial membrane.

What are common challenges in expressing and purifying functional MsbA protein and how can they be overcome?

Researchers working with MsbA from Erwinia carotovora subsp. atroseptica frequently encounter several challenges during expression and purification. The following table outlines common issues and evidence-based solutions:

ChallengePotential CausesRecommended Solutions
Low expression yieldCodon bias, protein toxicityOptimize codon usage, use C41/C43(DE3) host strains, employ tightly regulated expression systems
Inclusion body formationRapid expression, improper foldingLower induction temperature (16-20°C), reduce inducer concentration, co-express chaperones
Poor solubilizationInadequate detergent, improper conditionsScreen detergent panel (DDM, LMNG, UDM), optimize detergent:protein ratio, include lipids during solubilization
Loss of activity during purificationDelipidation, oxidation, aggregationAdd lipids during purification, include reducing agents, minimize purification steps
Protein instabilityDetergent-induced destabilizationUse lipid nanodiscs or amphipols for final preparation, include stabilizing additives (glycerol, trehalose)
HeterogeneityMultiple conformational statesLock protein in specific state with nucleotides or inhibitors, use size exclusion chromatography for final homogeneity

For the specific case of Recombinant Full Length Erwinia carotovora subsp. atroseptica MsbA, expression in E. coli with an N-terminal His-tag has proven successful . Special attention should be paid to:

  • Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

How can researchers optimize functional assays to accurately measure MsbA transport activity?

Optimizing functional assays for MsbA transport activity requires careful consideration of multiple parameters. The following methodological framework addresses key aspects of assay development and optimization:

  • Substrate selection and preparation:

    • Use fluorescently labeled lipid A derivatives (NBD, BODIPY, or dansyl-labeled)

    • Prepare substrate micelles at concentrations below CMC to minimize passive diffusion

    • Include appropriate negative controls (heat-inactivated protein, known inactive mutants)

  • Reconstitution system optimization:

    • Proteoliposome preparation with defined lipid composition mimicking bacterial membranes

    • Control protein orientation by pH gradient or reconstitution method

    • Validate reconstitution efficiency using protease protection assays

  • Transport measurement techniques:

    • Fluorescence-based real-time monitoring for continuous data collection

    • Stopped-flow measurements for rapid kinetics

    • Radioactive substrate uptake for absolute quantification

  • Assay condition optimization:

    • pH, temperature, and ionic strength screening using factorial design

    • ATP regeneration system (pyruvate kinase/phosphoenolpyruvate) for sustained activity

    • Magnesium concentration optimization for maximal ATPase coupling

  • Data analysis refinement:

    • Background subtraction procedures for improved signal-to-noise ratio

    • Initial rate determination from early linear phase

    • Kinetic modeling incorporating both binding and transport steps

  • Validation strategies:

    • Correlation between ATPase activity and transport rates

    • Competition with unlabeled substrates to confirm specificity

    • Site-directed mutagenesis of key residues as functional controls

This systematic approach to assay optimization ensures reliable and reproducible measurement of MsbA transport activity, providing a solid foundation for detailed mechanistic studies and inhibitor screening.

What emerging technologies are being applied to study MsbA and other bacterial transporters?

The study of MsbA and related bacterial transporters is being revolutionized by several emerging technologies. These cutting-edge approaches offer new insights into structure, function, and dynamics:

  • Cryo-electron microscopy advancements:

    • Time-resolved cryo-EM to capture transient conformational states

    • Microcrystal electron diffraction (MicroED) for structure determination from nanocrystals

    • Correlative light and electron microscopy (CLEM) to link function and structure

  • Advanced fluorescence techniques:

    • Single-molecule fluorescence resonance energy transfer (smFRET) for real-time conformational changes

    • Metal-enhanced fluorescence (MEF) for improved sensitivity

    • Super-resolution microscopy (STORM, PALM) for visualization in native membranes

  • Artificial intelligence applications:

    • Machine learning for protein structure prediction (AlphaFold2, RoseTTAFold)

    • Neural networks for functional site prediction

    • Deep learning for drug discovery targeting transporters

  • Genome engineering approaches:

    • CRISPR-Cas9 base editing for precise genetic manipulation

    • In vivo tracking of protein dynamics using split fluorescent proteins

    • Optogenetic control of transporter expression and function

  • Integrated structural biology platforms:

    • Hybrid methods combining multiple structural techniques

    • Integrative modeling incorporating diverse experimental constraints

    • Time-resolved structural biology across multiple timescales

These emerging technologies are transforming our ability to understand MsbA function in its native context and will likely lead to significant breakthroughs in bacterial transporter research in the coming years.

How might research on Erwinia carotovora MsbA contribute to broader understanding of bacterial resistance mechanisms?

Research on MsbA from Erwinia carotovora subsp. atroseptica has significant potential to illuminate bacterial resistance mechanisms through several interconnected research avenues:

The periplasmic stress response system in Erwinia carotovora, which involves proteins like DsbA and DsbC, suggests complex feedback regulation mechanisms that affect gene expression in diverse ways . Understanding how MsbA functions within this network could reveal novel approaches to disrupting bacterial resistance mechanisms not only in plant pathogens but potentially in human pathogens as well.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.