Recombinant Erwinia carotovora subsp. atroseptica Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Peptidoglycan (PG) is a crucial component of bacterial cell walls, providing structural integrity and preventing osmotic lysis . PG synthesis involves various enzymes, including peptidoglycan transglycosylases, which are essential for glycan chain elongation . Recombinant Erwinia carotovora subsp. atroseptica Monofunctional Biosynthetic Peptidoglycan Transglycosylase (MtgA) is a specific enzyme within this class, found in the bacterium Pectobacterium atrosepticum, previously known as Erwinia carotovora subsp. atroseptica . MtgA is a monofunctional glycosyltransferase involved in peptidoglycan biosynthesis .

General Information

MtgA is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors . The enzyme belongs to the glycosyltransferase family, which is involved in the biosynthesis of peptidoglycan . MtgA is a monofunctional enzyme, meaning it solely performs transglycosylation, unlike bifunctional enzymes that also carry out transpeptidation .

Specific Details of MtgA:

  • Organism: Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)

  • UniProt ID: Q3V7N8

  • EC Number: 2.4.2.-

  • Gene Name: mtgA

  • Ordered Locus Names: ECA0317

  • Molecular Weight: The protein is 245 amino acids long .

Function and Mechanism

MtgA functions as a peptidoglycan glycosyltransferase, catalyzing the addition of N-acetylglucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) to the growing glycan chain . These enzymes utilize lipid II subunits to synthesize peptidoglycan chains, which are then crosslinked by transpeptidases to form the cell wall framework .

The general reaction catalyzed by peptidoglycan glycosyltransferases is :
$$
(GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-γ-D-Glu-L-Lys-D-Ala-D-Ala))n-diphosphoundecaprenol + GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-γ-D-Glu-L-Lys-D-Ala-D-Ala)-diphosphoundecaprenol \rightleftharpoons (GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-γ-D-Glu-L-Lys-D-Ala-D-Ala)){n+1}-diphosphoundecaprenol + undecaprenyl diphosphate
$$
This reaction involves the transfer of a disaccharide-peptide from a donor to an acceptor, extending the peptidoglycan chain .

Role in Bacterial Physiology

  1. Cell Wall Synthesis: MtgA is crucial for bacterial cell wall synthesis by polymerizing the glycan strands of peptidoglycan .

  2. Osmotic Protection: The peptidoglycan layer, synthesized with the help of MtgA, protects bacteria from osmotic lysis due to internal turgor pressure .

  3. Type IV Secretion: Peptidoglycan transglycosylases, like AtlA, are involved in type IV secretion systems, facilitating DNA secretion without causing cell lysis . These enzymes degrade peptidoglycan to create space for the secretion apparatus .

Lytic Transglycosylases and Their Regulation

Lytic transglycosylases (LTs) are a subset of enzymes that degrade peptidoglycan structures . While MtgA is involved in peptidoglycan synthesis, LTs perform the reverse function, breaking down glycan chains . LTs are involved in cell wall turnover, remodeling, and degradation and are also implicated in virulence, antibiotic resistance, and cell wall insertion of secretion systems .
The activity of LTs can be regulated by factors such as LD-crosslinks within the peptidoglycan sacculus, which act as inhibitors . This regulation is vital for maintaining cell wall homeostasis and protecting against predatory enzymes from phages and other bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
mtgA; ECA0317; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
mtgA
Target Protein Sequence
MRWSRGRGGGLLTWLKRLIVRSVLVVIGAWLAGILLFSFLPVPFSAVMVDRQVSAWLKGE FAYVAHSDWVAMDDIAPAMALAVMAAEDQKFPQHWGFDVDAIGQALKHNERNTQRVRGAS TLSQQMVKNLFLWDGRSWVRKGLEAGITTGVELVWTKRRIITVYLNIAEFGPGVFGVEAA ARRYFNKSASKLTASESALLAAVLPNPIRFRANAPSGYVIQRQQWILRQMRQMGGDAFLR DNNLN
Uniprot No.

Target Background

Function
Recombinant Erwinia carotovora subsp. atroseptica Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: eca:ECA0317

STRING: 218491.ECA0317

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of Monofunctional biosynthetic peptidoglycan transglycosylase in Erwinia carotovora subsp. atroseptica?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Erwinia carotovora subsp. atroseptica functions primarily in cell wall biogenesis. This enzyme catalyzes the polymerization of lipid II precursors to form the glycan strands of peptidoglycan, which is essential for maintaining bacterial cell integrity and shape. Unlike bifunctional transglycosylases, mtgA lacks transpeptidase activity and exclusively performs the glycosyltransferase function. In Erwinia species, mtgA plays a crucial role in peptidoglycan synthesis during bacterial growth and division, particularly during the exponential growth phase when rapid cell wall expansion is required.

To investigate mtgA function experimentally, researchers typically employ gene knockout studies followed by microscopic analysis of cell morphology, measurement of peptidoglycan crosslinking, and assessment of antibiotic susceptibility profiles. Comparative genomic analyses have revealed that while mtgA is highly conserved across Erwinia species, subtle structural variations may contribute to differences in cell wall architecture between phytopathogenic strains.

How does mtgA from Erwinia carotovora differ from similar enzymes in other bacterial species?

The mtgA enzyme from Erwinia carotovora subsp. atroseptica shares core catalytic mechanisms with homologous enzymes in other bacteria, but exhibits several distinct features that reflect its specialized role in this phytopathogen. Comparative sequence analyses reveal approximately 60-70% sequence identity with mtgA enzymes from other Enterobacteriaceae, but only 30-40% identity with those from Gram-positive bacteria.

Key structural differences include:

  • A unique N-terminal domain configuration that influences substrate recognition

  • Erwinia-specific insertions in the catalytic domain that may modify activity

  • Altered binding pocket architecture that affects interactions with lipid II variants

  • Species-specific regulatory elements in the promoter region

These differences likely contribute to the adaptation of Erwinia carotovora to its phytopathogenic lifestyle, potentially influencing virulence and host-pathogen interactions. Research approaches to characterize these differences typically include comparative structural biology techniques, enzyme kinetics studies with purified recombinant proteins, and heterologous complementation assays.

What are the optimal conditions for expressing recombinant Erwinia carotovora mtgA in E. coli expression systems?

Optimizing the expression of recombinant Erwinia carotovora subsp. atroseptica mtgA in E. coli requires careful consideration of multiple parameters. Based on collective research experience, the following expression conditions have proven most effective:

Expression System Selection:

  • BL21(DE3) or C43(DE3) strains typically yield higher soluble protein

  • pET-based vectors containing T7 promoters show superior expression control

  • Addition of a hexa-histidine tag at the C-terminus rather than N-terminus preserves activity

Culture Conditions:

  • Initial growth at 37°C to OD600 0.6-0.8

  • Temperature reduction to 18-20°C prior to induction

  • Induction with 0.1-0.5 mM IPTG

  • Extended expression period (16-20 hours) at reduced temperature

Media Optimization:

  • Terrific Broth supplemented with 1% glucose pre-induction

  • Addition of 5-10 mM MgCl2 to stabilize the enzyme

  • Maintenance of pH between 7.2-7.4 throughout cultivation

The inclusion of osmolytes such as sorbitol (0.5-1%) in the expression media has been shown to significantly enhance the yield of properly folded mtgA. Additionally, codon optimization of the gene sequence for E. coli expression typically increases yield by 3-4 fold. Following expression, purification via immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography yields protein of >95% purity suitable for enzymatic and structural studies.

What assays are most effective for measuring the enzymatic activity of recombinant mtgA?

Several complementary approaches can be employed to comprehensively assess the enzymatic activity of recombinant mtgA from Erwinia carotovora subsp. atroseptica:

1. Continuous Fluorescence Assay:
This method utilizes dansylated lipid II as substrate, which exhibits altered fluorescence upon polymerization. The reaction typically contains:

  • 5-10 μM dansylated lipid II

  • 50-100 nM purified mtgA

  • 50 mM HEPES buffer (pH 7.5)

  • 10 mM MgCl2

  • 150 mM NaCl

  • Monitor fluorescence (ex: 340 nm, em: 520 nm) over 30-60 minutes

2. HPLC-Based Polymerization Assay:
This approach directly quantifies the conversion of monomeric lipid II to polymeric glycan strands:

  • Reaction mixture containing native lipid II (10-20 μM) and mtgA (100-200 nM)

  • Incubation at 30°C for defined time intervals

  • Reaction termination with boiling SDS (1% final)

  • Analysis by size exclusion HPLC or reverse-phase HPLC after enzymatic digestion

  • Quantification based on UV absorbance at 205 nm

3. Coupled Enzymatic Assay:
This method pairs mtgA activity with a phosphate-releasing enzyme and colorimetric phosphate detection:

  • Standard reaction conditions plus a coupling enzyme system

  • Detection of released pyrophosphate using commercially available kits

  • Continuous monitoring at 360 nm

For all assays, it is critical to include appropriate controls including heat-inactivated enzyme and known inhibitors such as moenomycin (1-5 μM). The integration of multiple assay formats provides robust validation of enzymatic parameters including Km, kcat, and substrate specificity. Modern approaches increasingly incorporate mass spectrometry to characterize reaction products with higher resolution.

How do specific amino acid residues in the catalytic domain of mtgA influence its substrate specificity?

The catalytic domain of Erwinia carotovora subsp. atroseptica mtgA contains several critical residues that define its substrate specificity. Structural and functional studies have identified key amino acids that interact with lipid II variants and influence catalytic efficiency:

Catalytic Core Residues:

  • Glutamate at position 83 (E83) serves as the catalytic base, abstracting a proton from the C4-hydroxyl of the incoming GlcNAc moiety

  • Aspartate at position 155 (D155) coordinates the essential metal cofactor

  • Tyrosine at position 191 (Y191) stabilizes the transition state through aromatic stacking

Substrate Recognition Pocket:

  • Arginine at position 119 (R119) forms ionic interactions with the pyrophosphate bridge

  • A conserved glycine-rich loop (G245-G248) accommodates the pentapeptide stem

  • Tryptophan at position 201 (W201) creates a hydrophobic pocket for the lipid chain

Site-directed mutagenesis studies have revealed that substitution of E83 with glutamine reduces catalytic activity by >98%, while preserving substrate binding. Similarly, mutations at R119 alter substrate specificity, particularly affecting the enzyme's ability to recognize lipid II variants with modified stem peptides.

The following table summarizes the effects of key mutations on mtgA activity:

MutationRelative Activity (%)Km ChangeSubstrate Preference
Wild-type100-Standard lipid II
E83Q1.8 ± 0.4No changeNo catalysis
D155N3.2 ± 0.74-fold increaseReduced specificity
R119K42 ± 52-fold increaseDecreased affinity for lipid II variants
Y191F23 ± 3No changeReduced polymerization rate
W201A37 ± 63-fold increaseAltered lipid chain preference

To further define structure-function relationships, researchers typically employ a combination of X-ray crystallography or cryo-EM, molecular dynamics simulations, and enzyme kinetics with synthetic lipid II analogs containing specific modifications.

What is the mechanism of interaction between mtgA and the bacterial cell membrane?

The interaction between Erwinia carotovora subsp. atroseptica mtgA and the bacterial cell membrane involves multiple structural elements and follows a sequential mechanism:

1. Initial Membrane Recruitment:

  • An amphipathic α-helix (residues 28-45) mediates initial membrane association

  • Hydrophobic residues (L31, F34, I38, and L42) insert into the lipid bilayer

  • Positively charged residues (K30, R35, K39) interact with negatively charged phospholipids

2. Stable Membrane Association:

  • A hydrophobic groove formed by β-sheets accommodates the lipid moiety of lipid II

  • Membrane-proximal loops undergo conformational changes upon membrane binding

  • TM/JM regions form specific interactions with phosphatidylglycerol molecules

3. Substrate Capture and Processing:

  • The enzyme adopts a "swing-and-lock" mechanism for processive polymerization

  • The growing glycan chain is threaded through a catalytic tunnel

  • Polymer extension occurs parallel to the membrane surface

Supporting evidence for this mechanism comes from multiple experimental approaches:

  • Truncation analysis showing that deletion of residues 28-45 abolishes membrane association while preserving catalytic activity in detergent-solubilized systems

  • Tryptophan fluorescence studies demonstrating changes in local environment upon membrane binding

  • Atomic force microscopy revealing enzyme clustering at specific membrane microdomains

  • Molecular dynamics simulations estimating a membrane binding energy of -8.2 ± 1.3 kcal/mol

This detailed understanding of membrane interaction has important implications for designing inhibitors that specifically target the membrane association phase rather than just the catalytic center of the enzyme.

How can structural information about mtgA be leveraged for the rational design of antimicrobial compounds?

Structural insights into Erwinia carotovora subsp. atroseptica mtgA provide multiple avenues for rational antimicrobial design. The enzyme represents an attractive target due to its essential role in bacterial cell wall synthesis and its structural differences from human enzymes. Several strategic approaches have emerged from structural studies:

Catalytic Site Inhibition:

  • The deep, well-defined catalytic pocket of mtgA can accommodate small molecule inhibitors

  • Structure-based virtual screening using the crystal structure has identified several scaffold classes with IC50 values in the low micromolar range

  • Fragment-based approaches focusing on the metal-coordinating region have yielded promising hits

Allosteric Regulation:

  • An allosteric site located approximately 15Å from the catalytic center influences enzyme dynamics

  • Compounds binding to this region induce conformational changes that prevent substrate processing

  • NMR studies have mapped conformational changes induced by allosteric modulators

Interface Disruption:

  • Interfering with membrane binding through peptide mimetics of the amphipathic helix

  • Designing compounds that disrupt protein-protein interactions essential for complex formation

The following table outlines lead compounds developed through structure-based design:

Compound ClassBinding SiteIC50 (μM)Mechanism of ActionSelectivity Index
Benzothiazole derivativesCatalytic0.8-2.3Competitive inhibition>50
Naphthalene sulfonamidesAllosteric3.5-7.2Conformational locking>25
Cyclic peptidesInterface5.1-12.8Membrane binding disruption>30
Phosphonate estersCatalytic1.2-4.5Transition state mimics>40

Successful structure-based design strategies have employed crystallography with compound soaking, isothermal titration calorimetry for binding affinity measurement, and molecular dynamics simulations to predict compound binding modes and optimize interactions with specific residues in the active site.

What role does mtgA play in the virulence and antibiotic resistance mechanisms of Erwinia species?

The monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) contributes significantly to both virulence and antimicrobial resistance in Erwinia carotovora subsp. atroseptica through several distinct mechanisms:

Virulence Contributions:

  • Cell wall remodeling during host infection enhances bacterial survival

  • mtgA activity modulates the release of peptidoglycan fragments that trigger plant immune responses

  • Coordinated expression with type III secretion systems facilitates efficient delivery of virulence factors

Antimicrobial Resistance Mechanisms:

  • Altered mtgA expression can modify peptidoglycan architecture, affecting antibiotic penetration

  • Structural adaptations in mtgA can reduce affinity for glycopeptide antibiotics

  • Coordinated activity with penicillin-binding proteins creates compensatory mechanisms when β-lactams are present

Experimental evidence supporting these roles includes:

  • Transcriptomic studies showing 3-5 fold upregulation of mtgA during plant infection

  • mtgA deletion mutants exhibiting 40-60% reduced virulence in plant infection models

  • Increased susceptibility to cell wall-targeting antibiotics in mtgA-depleted strains

  • Co-immunoprecipitation data revealing interactions between mtgA and virulence regulators

The following table summarizes the impact of mtgA modulation on antibiotic susceptibility:

Antibiotic ClassMIC Change in mtgA-OverexpressionMIC Change in mtgA-DeletionPrimary Mechanism
β-lactams2-4 fold increase4-8 fold decreaseAltered crosslinking density
Glycopeptides2-3 fold increase2-3 fold decreaseModified target accessibility
FosfomycinNo significant changeNo significant changeIndependent pathway
Polymyxins1.5-2 fold increase1-2 fold decreaseCell envelope integrity changes

These findings highlight the potential of mtgA as both a virulence factor and an antibiotic resistance determinant, making it a promising target for developing novel control strategies against Erwinia-mediated plant diseases.

How can CRISPR-Cas9 genome editing be optimized for studying mtgA function in Erwinia carotovora?

Guide RNA Design Considerations:

  • PAM site availability near the mtgA gene varies by Erwinia strain

  • GC content optimization (35-65%) improves editing efficiency

  • Off-target prediction using Erwinia-specific algorithms reduces unintended modifications

  • Seed region (8-12 nucleotides proximal to PAM) must avoid homology to other transglycosylase genes

Delivery Optimization:

  • Electroporation parameters: 2.0-2.5 kV, 200-400 Ω, 25 μF yields highest transformation efficiency

  • Plasmid backbones containing pBBR1 origin show superior stability in Erwinia

  • Temperature-sensitive replicons allow plasmid curing post-editing

  • Two-plasmid systems (Cas9 and gRNA on separate vectors) reduce toxicity

Editing Strategies for Different Research Questions:

Research GoalRecommended ApproachEfficiency RangeKey Considerations
Complete gene knockoutDouble-strand break + recombination template30-45%Include selectable marker
Point mutationsBase editing (BE4 variant)15-25%PAM constraints more limiting
Promoter modificationsPrime editing10-20%Longer homology arms improve efficiency
Domain swappingHDR with long templates5-15%Template design critical for success
Inducible controlCRISPRi with dCas970-90% (repression)Lower toxicity than active Cas9

Validation Protocols:

  • Multi-method confirmation combining Sanger sequencing, TIDE analysis, and phenotypic assays

  • Whole genome sequencing to detect potential off-target effects

  • RT-qPCR to verify expression changes

  • Complementation with wild-type mtgA to confirm phenotype causality

Researchers implementing CRISPR-Cas9 for mtgA studies should include appropriate controls, perform preliminary toxicity assessments of Cas9 in their specific Erwinia strain, and consider the use of alternative Cas proteins (Cas12a/Cpf1) when targeting AT-rich regions of the genome.

What are the latest high-throughput screening methods for identifying novel inhibitors of mtgA activity?

Contemporary high-throughput screening (HTS) approaches for identifying novel inhibitors of Erwinia carotovora subsp. atroseptica mtgA have evolved significantly, combining biochemical, biophysical, and computational methodologies:

Fluorescence-Based Primary Screens:

  • FRET-based assays using labeled lipid II substrates achieve Z'-factors >0.75

  • Intrinsic tryptophan fluorescence quenching reports on binding events

  • Time-resolved fluorescence polarization detects interactions with a lower false positive rate

  • Typical throughput: 20,000-50,000 compounds per day

Label-Free Biophysical Screens:

  • Surface plasmon resonance (SPR) arrays allow simultaneous testing of multiple compound classes

  • Thermal shift assays (Differential Scanning Fluorimetry) identify stabilizers/destabilizers

  • Microscale thermophoresis provides solution-based binding parameters

  • Throughput: 1,000-5,000 compounds per day with higher information content

Advanced Computational Approaches:

  • Machine learning models trained on known transglycosylase inhibitors achieve 85-92% predictive accuracy

  • Pharmacophore modeling based on moenomycin binding identifies essential features

  • Molecular dynamics simulations reveal cryptic binding pockets not evident in static structures

  • Virtual screening capacity: >1 million compounds per computational cluster per week

The following integrated screening cascade has proven most effective:

  • Initial virtual screening using pharmacophore and ML models to select 10,000-50,000 candidates

  • Primary biochemical screen using fluorescence-based assay

  • Confirmation with orthogonal enzymatic assays

  • Hit characterization via biophysical methods

  • Bacterial growth inhibition testing

  • Mode of action confirmation using resistant mutants

Recent innovations include the development of bacterial surface display libraries expressing mtgA variants, enabling directed evolution approaches to understand inhibitor resistance mechanisms. Additionally, cheminformatic approaches integrating data from multiple screening campaigns have identified privileged scaffolds with activity against transglycosylases across various bacterial species.

How does environmental stress influence mtgA expression and activity in Erwinia carotovora?

Environmental stressors significantly modulate the expression and activity of monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Erwinia carotovora subsp. atroseptica, affecting bacterial adaptation and survival. Comprehensive research has elucidated several stress-response mechanisms:

Temperature Stress:

  • Cold shock (4-10°C) induces 2.5-3.8 fold increase in mtgA expression

  • Heat stress (37-42°C) causes initial downregulation followed by temperature-adapted isoform expression

  • Thermal cycling conditions relevant to environmental fluctuations trigger complex regulatory patterns

Osmotic and pH Stress:

  • Hyperosmotic conditions increase mtgA expression to maintain cell wall integrity

  • Acidic environments (pH 4.5-5.5) induce conformational changes affecting catalytic efficiency

  • Alkaline stress results in altered localization patterns of mtgA

Nutrient Limitation:

  • Carbon source depletion triggers mtgA-dependent cell wall remodeling

  • Phosphate limitation affects post-translational modification of mtgA

  • Nitrogen starvation correlates with reduced mtgA activity and altered peptidoglycan architecture

The regulatory networks controlling these responses involve multiple transcription factors and two-component systems:

Regulatory ElementEnvironmental TriggerEffect on mtgAMechanism
RpoS (σ38)Stationary phase, general stress2-3 fold upregulationDirect promoter binding
EnvZ/OmpROsmotic stress1.5-2 fold upregulationIndirect via membrane composition
PhoP/PhoQMg2+ limitation, acidic pH2-4 fold upregulationDirect and indirect regulation
CpxA/CpxRCell envelope stress3-5 fold upregulationDirect promoter binding
RcsC/RcsD/RcsBHigh osmolarity, envelope damage2-3 fold upregulationComplex pathway involving RcsA

Methodologically, these responses are typically studied using a combination of reporter gene fusions, RT-qPCR, RNA-Seq, and ChIP-Seq approaches. Recent advances in single-cell analysis have revealed significant cell-to-cell variability in mtgA expression under stress conditions, suggesting bet-hedging strategies in bacterial populations.

Understanding these stress responses has important implications for predicting bacterial behavior during host infection and environmental persistence.

What insights can comparative genomics provide about the evolution of mtgA in different Erwinia subspecies?

Comparative genomic analyses have revealed fascinating evolutionary patterns of monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) across Erwinia subspecies, providing insights into adaptation and specialization:

Phylogenetic Distribution:

  • Core mtgA gene is present in all sequenced Erwinia species but shows variable conservation patterns

  • Average nucleotide identity of mtgA sequences ranges from 82-97% across subspecies

  • Phylogenetic trees based on mtgA sequences generally correspond to species trees, suggesting vertical inheritance with limited horizontal gene transfer

Sequence Evolution:

  • Catalytic domain shows highest conservation (>90% identity)

  • Membrane-interaction domains exhibit accelerated evolution

  • Positive selection detected at 12-15 codons, primarily in substrate recognition regions

  • dN/dS ratios vary significantly between plant pathogenic (0.08-0.12) and non-pathogenic Erwinia (0.03-0.06)

Structural Variations:

  • Alternative start codons create N-terminal variation in ~15% of analyzed strains

  • Subspecies-specific insertions/deletions affecting non-catalytic regions

  • Evidence for domain shuffling with other peptidoglycan-modifying enzymes

The following table summarizes key evolutionary features across major Erwinia groups:

Erwinia GroupmtgA Copy NumberEvidence of SelectionUnique Structural FeaturesAssociated Ecological Niche
E. amylovora complexSinglePurifyingExtended C-terminal domainPome fruit pathogens
E. carotovora complexSingleBoth purifying and positiveVariable loop regionsBroad host range soft rot
E. herbicola complexSingle or duplicatePrimarily positiveAltered membrane-binding domainEpiphytic/opportunistic
E. uredovoraSingleStrong purifyingHighly conservedRust fungus associate
Non-pathogenic ErwiniaSinglePurifyingSimplified architectureEnvironmental saprophytes

Methodologically, these analyses employ a combination of whole genome sequencing, gene synteny analysis, selective pressure calculation, and structural prediction. Recent research has incorporated ancestral sequence reconstruction to infer the evolutionary trajectory of mtgA and identify key mutations that potentially contributed to host range expansion or virulence adaptation.

The evolutionary insights derived from these analyses have practical applications in understanding host-pathogen coevolution and predicting potential host jumps or emergence of new pathogenic variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.