Recombinant Erwinia carotovora subsp. atroseptica NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction

Erwinia carotovora subsp. atroseptica, now known as Pectobacterium atrosepticum, is a Gram-negative bacterium known for causing blackleg disease in potatoes and soft rot in various vegetables . NADH-quinone oxidoreductase subunit A (nuoA) is a component of the NADH:quinone oxidoreductase I (NDH-1) complex, which is essential for bacterial respiration . The NDH-1 complex, also referred to as complex I, is a large enzyme complex found in the cytoplasmic membrane of bacteria, where it catalyzes the transfer of electrons from NADH to quinones, coupled with the translocation of protons across the membrane .

Identification and Characteristics

Identification
NameNADH-quinone oxidoreductase subunit A
SynonymsNuoA
Gene NamenuoA
Biological Properties
General FunctionOxidoreductase activity, acting on NADH or NADPH
Specific FunctionTransports electrons from NADH to quinones; couples redox reaction to proton translocation, conserving redox energy in a proton gradient
Cellular LocationCell inner membrane; multi-pass membrane protein

Function and Role of NuoA

NADH-quinone oxidoreductase subunit A (NuoA) is a crucial component of the NDH-1 complex, which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain . This process is coupled with the translocation of protons across the cytoplasmic membrane, contributing to the generation of a proton gradient that drives ATP synthesis .

The NDH-1 complex consists of several subunits, including NuoA, NuoB, NuoCD, NuoE, NuoF, NuoG, NuoI, NuoH, NuoJ, NuoK, NuoL, NuoM, and NuoN . NuoA is a membrane-bound subunit that plays a role in the proton translocation activity of the complex .

Regulation and Significance

The expression and activity of the NDH-1 complex, including the NuoA subunit, can be influenced by various factors. One key regulator in Erwinia carotovora is RsmA, a global repressor that controls the production of extracellular enzymes, plant pathogenicity, and synthesis of quorum-sensing signals . RsmA affects the levels of transcripts involved in the biosynthesis of these signals, which in turn regulate the production of extracellular enzymes and other virulence factors .

Potential Applications

ApplicationDescription
Drug DiscoveryUnderstanding the structure and function of NuoA and the NDH-1 complex may offer targets for developing novel antibacterial agents.
BiotechnologyModifying the activity of NuoA or the NDH-1 complex could enhance the metabolic capabilities of bacteria for biotechnological applications.
Plant Disease ManagementTargeting NuoA or related components may disrupt the energy metabolism of Pectobacterium atrosepticum, potentially reducing its virulence and impact on crops.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To prioritize a specific tag, please indicate your preference during ordering.
Synonyms
nuoA; ECA3028; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
nuoA
Target Protein Sequence
MSTTTEILAHHWAFALFLIIAIGLCVFMLTGGFLLGGRAKGRAKNVPYESGIDSVGSARL RLSAKFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGA LDWTPVRSKRQVVKSDIINTTNTHPQ
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is the presumed immediate electron acceptor. This process couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This mechanism conserves redox energy as a proton gradient.
Database Links

KEGG: eca:ECA3028

STRING: 218491.ECA3028

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Erwinia carotovora metabolism?

NADH-quinone oxidoreductase (Complex I) in Erwinia carotovora functions as the entry point of the electron transport chain, catalyzing electron transfer from NADH to quinone coupled with proton translocation across the membrane. This process is essential for energy metabolism, generating the proton motive force necessary for ATP synthesis. In bacterial systems like E. carotovora, the NADH-quinone oxidoreductase complex contains multiple subunits, with nuoA being one of the membrane-embedded components involved in proton translocation . Unlike the multi-subunit complexes in most bacteria, some organisms like Saccharomyces cerevisiae possess single-subunit NADH dehydrogenases that can functionally replace Complex I .

What cloning strategies are most effective for isolating the nuoA gene from Erwinia carotovora subsp. atroseptica?

For effective cloning of nuoA from E. carotovora subsp. atroseptica, researchers should consider the following protocol:

  • Genomic DNA isolation: Extract high-quality genomic DNA using phenol-chloroform extraction or commercial kits optimized for gram-negative bacteria.

  • PCR amplification: Design specific primers based on the conserved regions of nuoA, incorporating appropriate restriction sites for subsequent cloning.

  • Vector selection: ColE1-based plasmids (pBR322, pBR325, pAT153) have proven effective as cloning vectors for E. carotovora genes, with transformation frequencies ranging from 1 × 10² to 4 × 10⁴ colonies per microgram of plasmid DNA .

  • Transformation method: Use a modified version of Hanahan's method for efficient transformation of E. carotovora DNA into E. coli .

  • Confirmation: Verify successful cloning through restriction analysis, PCR screening, and sequencing.

What expression systems provide optimal yields of functional recombinant nuoA protein?

The E. coli BL21(DE3) expression system has demonstrated high efficiency for producing recombinant proteins from E. carotovora, as evidenced by successful expression of other E. carotovora enzymes like L-asparaginase II . Optimal expression conditions typically include:

ParameterOptimal ConditionNotes
Induction timingOD₆₀₀ of 0.6-0.8Mid-log phase yields best results
IPTG concentration0.5-1.0 mMHigher concentrations may lead to inclusion bodies
Expression temperature25-30°CLower temperatures enhance proper folding
Expression duration18 hoursAs observed in L-asparaginase II studies
Media compositionDO-stat feeding strategyDemonstrated highest enzyme yields (98,000 U/L)

When expressing membrane proteins like nuoA, consider using specialized E. coli strains (C41, C43) designed for membrane protein expression, or fusion tags (MBP, SUMO) to enhance solubility.

How can researchers verify the structural integrity of recombinant nuoA protein?

To confirm structural integrity and proper folding of recombinant nuoA:

  • SDS-PAGE and Western blotting: Determine protein size and purity

  • Circular dichroism (CD) spectroscopy: Assess secondary structure elements

  • Limited proteolysis: Compare digestion patterns between recombinant and native proteins

  • NADH oxidation assay: Measure enzymatic activity using NADH as substrate and monitoring absorbance decrease at 340 nm

  • Quinone reduction assay: Monitor the reduction of various quinone substrates spectrophotometrically

  • Reconstitution experiments: Incorporate purified protein into liposomes to verify membrane integration and function

What are the challenges in purifying active membrane-bound nuoA and how can they be overcome?

Purification of membrane proteins like nuoA presents several challenges:

  • Detergent selection: Screen multiple detergents including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin to identify optimal solubilization conditions.

  • Protein stability: Include stabilizing agents like glycerol (10-20%), specific lipids, and protease inhibitors throughout purification.

  • Aggregation prevention: Implement size-exclusion chromatography as a final purification step to remove aggregates and ensure homogeneity.

  • Activity preservation: Develop a reconstitution protocol using E. coli polar lipid extracts to form proteoliposomes that maintain nuoA activity.

  • Purification strategy: A comprehensive approach using the table below:

Purification StepMethodPurposeCritical Parameters
Membrane isolationDifferential centrifugationSeparate membrane fraction40,000×g, 1 hour
Membrane solubilizationDetergent treatmentExtract membrane proteins1% DDM, 4°C, 2 hours
Affinity chromatographyNi-NTA (for His-tagged protein)Primary purification20-250 mM imidazole gradient
Ion exchangeDEAE or Q-SepharoseRemove contaminantspH 7.5, 0-500 mM NaCl gradient
Size exclusionSuperdex 200Achieve final purity0.03% DDM in running buffer

How does the nuoA subunit contribute to electron transport and proton pumping mechanisms?

The nuoA subunit plays a critical role in the proton translocation mechanism of NADH-quinone oxidoreductase (Complex I):

  • Structural analysis: nuoA contains transmembrane helices that form part of the membrane domain of Complex I, contributing to the proton translocation pathway.

  • Conserved residues: Key charged amino acids (Glu, Asp, His) within nuoA's transmembrane helices likely participate directly in proton transfer.

  • Subunit interactions: nuoA interacts with adjacent subunits (particularly nuoH, nuoJ, and nuoK) to form a functional proton channel.

  • Conformational changes: Electron transfer through the peripheral arm of Complex I induces conformational changes that are transmitted to nuoA, coupling electron transport to proton pumping.

Research suggests that single-subunit NADH dehydrogenases can functionally substitute for the entire Complex I in some systems, indicating alternative electron transport mechanisms that bypass the proton-pumping function .

What role might nuoA play in virulence and pathogenicity of Erwinia carotovora subsp. atroseptica?

The potential role of nuoA in virulence mechanisms of E. carotovora subsp. atroseptica involves:

  • Energy provision for virulence factors: As part of the respiratory chain, nuoA contributes to ATP generation needed for producing and secreting virulence factors including pectate lyase (Pel), polygalacturonase (Peh), cellulase (Cel), and protease (Prt) .

  • Adaptation to microaerobic plant environments: E. carotovora encounters oxygen-limited conditions within plant tissues, where efficient NADH oxidation by Complex I becomes crucial for maintaining redox balance.

  • Stress resistance: Functional nuoA may contribute to bacterial survival under oxidative stress conditions generated by plant defense responses.

  • Persistence in host tissues: Energy generation via respiratory chain is essential for bacterial growth during infection and colonization of plant tissues.

Unlike virulence-specific factors directly regulated by quorum sensing systems such as N-acylated homoserine lactone (AHL) signaling molecules , nuoA likely provides the metabolic foundation necessary for pathogenicity rather than being a virulence determinant itself.

How can site-directed mutagenesis of key residues in nuoA provide insights into Complex I function?

Site-directed mutagenesis of nuoA can reveal crucial functional insights through:

  • Identification of proton-conducting residues: Mutate conserved charged amino acids (Glu, Asp, His) in transmembrane helices to investigate their role in proton translocation.

  • Subunit interface analysis: Target residues at the interface with adjacent subunits to understand inter-subunit communication.

  • Experimental approach:

    • Create point mutations using overlap extension PCR

    • Express wild-type and mutant proteins under identical conditions

    • Compare activities using:

      • NADH:quinone oxidoreductase activity assays

      • Proton pumping measurements in reconstituted proteoliposomes

      • Growth complementation in E. coli Complex I-deficient strains

  • Expected outcomes: Different mutations may result in:

    • Complete loss of activity (essential residues)

    • Reduced electron transfer without affecting proton pumping (coupling sites)

    • Normal electron transfer with impaired proton pumping (proton channel residues)

    • Altered substrate specificity (binding pocket residues)

What techniques are most effective for studying interactions between nuoA and other Complex I subunits?

To investigate subunit interactions within the NADH-quinone oxidoreductase complex:

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can capture direct interactions between nuoA and neighboring subunits.

  • Co-immunoprecipitation: Using antibodies against nuoA to pull down interacting partners, followed by identification via mass spectrometry.

  • Bacterial two-hybrid system: Particularly useful for membrane protein interactions, using split adenylate cyclase or split ubiquitin systems.

  • FRET analysis: Fusion of fluorescent proteins to nuoA and potential interacting partners to measure energy transfer as an indicator of proximity.

  • Genetic suppressor analysis: Identification of mutations in other subunits that can suppress the phenotypic effects of nuoA mutations.

  • Cryo-electron microscopy: For structural characterization of the entire complex at near-atomic resolution, revealing the position and interactions of nuoA.

The study of yeast NDI1 expression in mammalian cells demonstrates that single-subunit NADH dehydrogenases can functionally replace Complex I, suggesting a potential approach for investigating nuoA function through complementation studies .

What genetic modification techniques have proven most successful for nuoA gene manipulation in Erwinia carotovora?

Several genetic modification approaches have demonstrated efficacy with E. carotovora genes:

  • Homologous recombination: Using suicide vectors carrying nuoA with flanking homologous regions to achieve chromosomal integration.

  • Transposon mutagenesis: Tn5 insertional mutagenesis has been successfully used for gene disruption in E. carotovora .

  • Lambda Red recombination: For targeted gene replacement without leaving antibiotic resistance markers.

  • CRISPR-Cas9 system: Emerging technique for precise genome editing in bacterial systems, allowing scarless modifications.

  • Antibiotic resistance markers: The nptII (kanamycin resistance), cat (chloramphenicol resistance), and aadA (spectinomycin/streptomycin resistance) genes have been successfully used as selectable markers in E. carotovora .

For functional studies of recombinant nuoA, complementation of E. coli Complex I mutants has proven valuable, with transformation frequencies ranging from 1 × 10² to 4 × 10⁴ colonies per microgram of plasmid DNA using ColE1-based plasmids .

How does the recombinant Erwinia carotovora nuoA compare functionally to homologous proteins from other bacteria?

Comparative functional analysis between E. carotovora nuoA and homologs from other bacterial species reveals:

OrganismSequence Identity (%)Functional DifferenceExperimental Evidence
Escherichia coli65-75 (estimated)Similar core function, differences in regulatory responsesComplementation assays
Pseudomonas spp.60-70 (estimated)Potentially different quinone specificitiesEnzyme kinetics with various quinones
Yeast NDI1 (alternative enzyme)<30 (non-homologous)Single subunit, no proton pumpingFunctional replacement in mammalian cells

The single-subunit NADH dehydrogenase from Saccharomyces cerevisiae (Ndi1P) can function as an alternative to Complex I in mammalian cells, providing resistance to Complex I inhibitors such as rotenone and pyridaben . This suggests that while structurally different, the fundamental electron transfer function can be preserved across diverse systems.

What are the latest advances in understanding the structure-function relationship of nuoA in the NADH-quinone oxidoreductase complex?

Recent structural insights have revealed:

  • Cryo-EM structures: High-resolution structures of bacterial Complex I have positioned nuoA within the membrane domain, showing its contribution to the proton translocation pathway.

  • Conserved motifs: Identification of highly conserved residues across bacterial species suggests functionally critical regions within nuoA.

  • Conformational changes: Evidence for structural rearrangements in the membrane domain during the catalytic cycle, potentially involving nuoA.

  • Lipid interactions: Specific lipid binding sites have been identified in the membrane domain that may influence nuoA function.

  • Supramolecular assemblies: Complex I can form supercomplexes with other respiratory chain components, with nuoA potentially involved in these higher-order interactions.

These structural insights provide a foundation for understanding how electron transfer through the peripheral arm couples to proton translocation through the membrane domain containing nuoA.

How can recombinant nuoA be utilized in developing novel antimicrobial strategies against plant pathogens?

Recombinant nuoA protein offers several avenues for developing antimicrobial approaches:

  • Target-based drug discovery: Using purified recombinant nuoA to screen for specific inhibitors that could disrupt energy metabolism in E. carotovora without affecting plant respiratory complexes.

  • Structural vaccinology: Identifying surface-exposed epitopes of nuoA that could be targeted by engineered antibodies or other binding proteins to disrupt bacterial respiration.

  • Competitive inhibition: Developing non-functional nuoA analogs that could integrate into the complex and disrupt its assembly or function.

  • Resistance mechanism studies: Understanding how mutations in nuoA might confer resistance to existing antibiotics, informing combination therapy approaches.

  • Biofilm prevention: Targeting energy metabolism through nuoA inhibition could prevent biofilm formation, a key virulence trait of many plant pathogens.

Field tests have demonstrated that genetically engineered strains of E. carotovora with modifications in bacterial secretion systems show reduced virulence , suggesting that metabolic targets like nuoA could similarly be exploited to control plant diseases.

What insights can studies of E. carotovora nuoA provide for understanding mitochondrial complex I disorders?

Research on bacterial nuoA has implications for understanding human mitochondrial disorders:

  • Structural homology: Despite evolutionary distance, bacterial nuoA shares structural and functional similarities with mitochondrial complex I subunits.

  • Disease mechanisms: Bacterial models allow investigation of how specific mutations affect assembly, stability, and function of the respiratory complex.

  • Therapeutic development: The successful expression of yeast NDI1 in mammalian cells demonstrates that alternative NADH dehydrogenases can bypass complex I defects , suggesting potential therapeutic approaches for mitochondrial disorders.

  • Functional testing platform: Bacterial systems provide a simplified model for testing the functional impact of mutations identified in patients with mitochondrial disorders.

  • Drug screening: Bacterial nuoA can serve as a surrogate target for identifying compounds that might modulate complex I activity, potentially leading to therapeutics for mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.