Recombinant Erwinia carotovora subsp. atroseptica NADH-quinone oxidoreductase subunit K (nuoK)

What is Erwinia carotovora subsp. atroseptica and why is it significant in research?

Erwinia carotovora subsp. atroseptica (now reclassified as Pectobacterium atrosepticum) is a gram-negative, rod-shaped bacterial plant pathogen that causes soft rot disease in potato crops and other plants. This pathogen has significant economic importance in agriculture due to its devastating effects on cash crops such as potatoes. Research on this organism is critical for understanding bacterial plant pathogenesis mechanisms and developing control strategies. The bacterium produces enzymes that macerate plant tissue, leading to characteristic soft rot symptoms that can occur in fields and during storage . Different isolates of E. carotovora demonstrate varying levels of aggressiveness, with some strains (such as Ecc 5) causing severe and sudden rottening of tubers, while others (like Ecc 1) show lower virulence with only slight tissue degradation .

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in bacterial metabolism?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the NADH dehydrogenase I complex (NDH-1), which is critical in bacterial respiratory chains. This membrane-embedded protein participates in the first step of oxidative phosphorylation, where it helps transfer electrons from NADH to quinone, simultaneously pumping protons across the membrane to generate the proton motive force needed for ATP synthesis. The complete amino acid sequence of the nuoK protein (100 amino acids) from E. carotovora subsp. atroseptica is: MIPLQHGLILAAILFVLGLTGLLIRRNLLFMLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG . Analysis of this sequence indicates that nuoK is a highly hydrophobic protein with multiple transmembrane domains, consistent with its role in the membrane-bound respiratory complex.

How does recombinant nuoK differ from native nuoK in experimental applications?

Recombinant nuoK proteins are engineered versions expressed in heterologous systems (typically E. coli) that often include affinity tags to facilitate purification and detection. The recombinant form of E. carotovora nuoK available for research typically includes an N-terminal His-tag and covers the full-length protein (amino acids 1-100) . While the core structure remains similar to the native protein, these modifications can affect certain experimental parameters:

When designing experiments, researchers should consider whether the tag might interfere with protein function, particularly since nuoK is a membrane protein where N-terminal modifications could potentially affect membrane insertion or protein-protein interactions within the respiratory complex.

What experimental approaches can be used to study nuoK function in E. carotovora pathogenicity?

Understanding nuoK's role in pathogenicity requires multiple complementary approaches:

• Gene knockout/complementation studies: Creating nuoK deletion mutants in E. carotovora followed by phenotypic characterization and complementation with the wild-type gene can reveal its contribution to virulence. Potato slice inoculation assays can be used to quantify changes in maceration ability, similar to methods used for studying other E. carotovora virulence factors .

• Respiration chain analysis: Since nuoK is part of the respiratory complex I, measuring changes in bacterial respiration rates, membrane potential, and ATP generation in wild-type versus nuoK mutants can reveal metabolic impacts.

• Metabolomic profiling: Comparing metabolite profiles between wild-type and nuoK-deficient strains can identify metabolic pathways affected by the disruption of respiratory function.

• Protein interaction studies: Techniques like bacterial two-hybrid systems or co-immunoprecipitation can identify protein partners that interact with nuoK, potentially revealing connections to virulence pathways.

• Plant infection models: Developing standardized infection models using potato tuber slices with different bacterial densities and monitoring disease progression. This can be quantified using a 0-7 rating scale for maceration severity, which allows for statistical comparison between wild-type and mutant strains .

How does nuoK contribute to quorum sensing regulation in E. carotovora?

While nuoK itself is not directly involved in quorum sensing, respiratory chain function and bacterial metabolism are interconnected with virulence regulation in E. carotovora. Quorum sensing (QS) in E. carotovora relies primarily on N-acyl homoserine lactones (AHLs) that regulate virulence gene expression . Research indicates that:

• Disruption of energy metabolism (where nuoK plays a role) can affect AHL production and response.

• Targeting QS pathways through lactonase enzymes (like AiiA from Bacillus thuringiensis) can effectively suppress E. carotovora pathogenicity, as demonstrated by studies projecting N-acyl homoserine lactonase onto the surface of Pseudomonas putida cells .

• The relationship between respiratory chain components and QS could be bidirectional - QS may regulate expression of respiratory genes including nuoK under certain conditions, while respiratory function may influence the energy available for AHL production.

Experimental design to study this relationship could include analyzing nuoK expression under different QS conditions and evaluating how nuoK mutations affect AHL production and response. Surface display systems expressing lactonase enzymes have shown remarkable suppressive effects on E. carotovora infection, suggesting a potential biotechnological application connecting respiratory chain research to pathogen control strategies .

What structural and functional insights can be gained from studying the membrane topology of nuoK?

The nuoK protein has a distinct membrane topology that is critical to its function in the NADH-quinone oxidoreductase complex. Analysis of its 100-amino acid sequence (MIPLQHGLILAAILFVLGLTGLLIRRNLLFMLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG) reveals several key structural features :

• Transmembrane domains prediction: Hydropathy analysis indicates nuoK likely contains 3 transmembrane helices, consistent with its function as an integral membrane protein.

• Conservation analysis: Alignment of nuoK sequences across bacterial species reveals conserved residues that may be essential for proton translocation or complex assembly.

• Structural study approaches:

  • Cysteine-scanning mutagenesis with membrane-impermeable sulfhydryl reagents can map accessible regions

  • Fusion reporter systems (PhoA/LacZ) can determine topology of loop regions

  • Cryo-EM studies of the entire complex can reveal nuoK's position and interactions

• Functional domains: The highly conserved charged residues within transmembrane domains likely participate in proton translocation, making them prime targets for site-directed mutagenesis studies.

Understanding this topology is critical for designing experiments that probe nuoK function without disrupting its membrane integration or complex assembly. This information also provides the foundation for structure-based drug design targeting respiratory complexes in bacterial pathogens.

What are the optimal conditions for expressing and purifying recombinant nuoK protein?

Successful expression and purification of recombinant nuoK requires careful optimization due to its hydrophobic nature as a membrane protein:

Expression System Optimization:

Purification Protocol:

• Cell lysis: Use gentle lysis methods (like enzymatic lysis with lysozyme) followed by membrane fraction isolation through differential centrifugation.

• Membrane protein solubilization: Solubilize membrane fractions using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration.

• Affinity purification: For His-tagged nuoK, use immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins. Include detergent in all buffers to maintain protein solubility .

• Quality control: Assess protein purity by SDS-PAGE (>90% purity is ideal) and verify identity by Western blot using anti-His antibodies or specific anti-nuoK antibodies .

• Storage: Store purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0, as recommended for the commercial preparation . For long-term storage, add 50% glycerol and store at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles .

How should researchers handle and reconstitute lyophilized nuoK protein for experimental use?

Proper handling of lyophilized nuoK protein is critical for maintaining its structural integrity and function:

Reconstitution Protocol:

• Initial handling: Briefly centrifuge the vial containing lyophilized protein before opening to ensure all material is at the bottom of the tube .

• Reconstitution solution: Dissolve the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

• Stabilization: Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) to prevent freeze-thaw damage .

• Aliquoting: Divide the reconstituted protein into single-use aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity .

• Working storage: For experiments that will span up to one week, store working aliquots at 4°C rather than repeatedly freezing and thawing .

Critical Considerations:

• The membrane protein nature of nuoK may require addition of detergent during reconstitution to maintain solubility

• Protein concentration should be verified after reconstitution using methods compatible with the buffer components

• Activity assays should be performed promptly after reconstitution to establish a baseline for protein functionality

What approaches can be used to validate the functional activity of recombinant nuoK protein?

Validating the functional activity of recombinant nuoK is challenging due to its role as part of a multi-subunit membrane complex. Several complementary approaches can be employed:

• Incorporation into proteoliposomes: Reconstitute nuoK with other purified NADH dehydrogenase complex subunits into artificial liposomes and measure:

  • NADH oxidation rates

  • Proton pumping efficiency using pH-sensitive fluorescent dyes

  • Membrane potential generation using voltage-sensitive dyes

• Complementation studies: Express recombinant nuoK in nuoK-deficient bacterial strains and assess restoration of:

  • NADH dehydrogenase complex assembly (by BN-PAGE)

  • Respiratory chain function (oxygen consumption rates)

  • Growth under conditions requiring respiratory chain function

• Binding assays: Evaluate binding to known interaction partners:

  • Co-purification with other NDH-1 complex subunits

  • Surface plasmon resonance (SPR) to measure interaction kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

• Structural integrity analysis: Assess proper folding using:

  • Circular dichroism (CD) spectroscopy to verify secondary structure content

  • Limited proteolysis to compare digestion patterns with native protein

  • Thermal shift assays to measure protein stability

How can researchers apply nuoK in studies of bacterial bioenergetics and antimicrobial development?

Recombinant nuoK protein serves as a valuable tool for investigating bacterial bioenergetics and developing novel antimicrobial strategies:

Bioenergetics Research Applications:

• Respiratory chain assembly studies: Using tagged nuoK to pull down interaction partners can reveal the assembly pathway of complex I in bacteria.

• Proton translocation mechanisms: Site-directed mutagenesis of conserved residues in nuoK can help map the proton translocation pathway through the membrane domain of complex I.

• Comparative bioenergetics: Studying nuoK variants from different bacterial species can reveal evolutionary adaptations in respiratory mechanisms.

Antimicrobial Development Applications:

• Target validation: Since respiratory chain components are essential for pathogen viability, nuoK and its interactions present potential antibiotic targets. In vitro assays with purified nuoK can screen for compounds that disrupt its function or incorporation into the complex.

• Biofilm formation studies: Investigating how respiratory chain disruption affects biofilm formation in E. carotovora could reveal new approaches to control persistent infections.

• Indirect pathogenicity control: Research has shown that targeting quorum sensing systems can reduce E. carotovora virulence . Studies examining the relationship between respiratory function (via nuoK) and quorum sensing could reveal synergistic approaches to pathogen control.

• Resistance mechanisms: Understanding how mutations in nuoK might confer resistance to respiratory chain inhibitors can inform antibiotic development strategies.

For application in antibiotic screening, high-throughput assays could be developed using recombinant nuoK incorporated into artificial membrane systems with fluorescent readouts for respiratory function, enabling rapid identification of inhibitory compounds specific to bacterial respiratory complexes.

What are common challenges in working with recombinant membrane proteins like nuoK and how can they be addressed?

Membrane proteins like nuoK present several distinct challenges in research settings:

Additional considerations specific to nuoK include ensuring the His-tag doesn't interfere with membrane insertion and monitoring protein orientation in reconstituted systems, as incorrect orientation would affect functional studies. When troubleshooting, systematic variation of buffer conditions, detergent types, and lipid compositions often resolves issues with membrane protein stability and function.

How can researchers differentiate between effects of nuoK mutation on bacterial metabolism versus direct effects on virulence?

Distinguishing metabolic from direct virulence effects requires careful experimental design:

• Growth rate normalization: When comparing wild-type and nuoK mutant strains, normalize infection doses based on viable cell counts rather than optical density to account for growth rate differences.

• Metabolic profiling: Use techniques like LC-MS or NMR to characterize metabolic changes in nuoK mutants, identifying shifts in central metabolism that might indirectly affect virulence.

• Controlled energy supplementation: Provide alternative energy sources or electron acceptors that bypass the need for complex I function to determine if virulence can be restored despite nuoK mutation.

• Temporal separation of experiments: Use inducible expression systems to turn nuoK expression on/off at different stages of infection to separate early metabolic effects from direct virulence contributions.

• Virulence factor expression analysis: Quantify expression of known virulence factors (like plant cell wall-degrading enzymes) in nuoK mutants versus wild-type under standardized conditions to determine if reduced virulence correlates with reduced virulence factor production.

• In vivo imaging: Use bioluminescent reporter strains to monitor bacterial metabolism and virulence gene expression simultaneously during infection, providing temporal correlation data.

By combining these approaches, researchers can build a comprehensive understanding of whether nuoK's role in virulence is primarily through supporting bacterial metabolism or through direct regulation of virulence mechanisms.

What emerging technologies could advance research on nuoK and respiratory complexes in plant pathogens?

Several cutting-edge technologies show promise for deepening our understanding of nuoK function:

• Cryo-electron tomography: This technique allows visualization of respiratory complexes in their native membrane environment, potentially revealing how nuoK orientation and interactions change under different physiological conditions.

• Nanoscale secondary ion mass spectrometry (NanoSIMS): By incorporating isotope-labeled amino acids into nuoK, researchers can track protein turnover rates in different infection stages, providing insights into the dynamics of respiratory complex remodeling during pathogenesis.

• Single-molecule tracking: Using fluorescently labeled nuoK variants, researchers can observe the real-time dynamics of respiratory complex assembly and localization within bacterial membranes during host interaction.

• CRISPR interference (CRISPRi): This approach allows tunable repression of nuoK expression, enabling dose-dependent studies of how reduced (but not absent) nuoK impacts both metabolism and virulence.

• Computational approaches: Molecular dynamics simulations of nuoK within membrane environments can predict conformational changes associated with proton translocation and identify critical residues for targeted mutagenesis.

• Surface display systems: Building on the success of displaying enzymes like lactonase on bacterial surfaces to combat E. carotovora , similar approaches could be developed to disrupt respiratory function specifically in pathogens.

Each of these technologies offers unique advantages for understanding the structure-function relationships of nuoK and its role in bacterial physiology and pathogenesis.

How might research on nuoK contribute to sustainable agricultural practices for controlling soft rot disease?

Research on nuoK and bacterial respiratory complexes could lead to several innovative approaches for controlling soft rot disease in an environmentally sustainable manner:

• Targeted antimicrobials: Understanding the unique structural features of E. carotovora nuoK could guide development of narrow-spectrum inhibitors that specifically target plant pathogens while sparing beneficial soil microbiota.

• Metabolic weakening strategies: Identifying conditions that increase bacterial reliance on nuoK-containing complexes could reveal environmental modifications that selectively disadvantage E. carotovora in agricultural settings.

• Biocontrol enhancement: Research has already demonstrated that antagonistic bacteria expressing AHL-degrading enzymes can suppress E. carotovora virulence . Understanding the link between quorum sensing and respiratory function might reveal synergistic biocontrol approaches.

• Resistant crop development: Knowledge of how E. carotovora respiration adapts during infection could inform breeding programs to select for plant varieties that create challenging metabolic environments for the pathogen.

• Early detection methods: Targeting unique epitopes of nuoK or its metabolic products could enable development of sensitive biosensors for early detection of E. carotovora contamination in seed potatoes or soil.

These approaches align with integrated pest management principles by providing multiple control strategies that reduce reliance on broad-spectrum antimicrobials while targeting specific vulnerabilities in the pathogen's physiology.