Recombinant Erwinia carotovora subsp. atroseptica Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Erwinia carotovora subsp. atroseptica: Bacterial Context and Significance

Erwinia carotovora subspecies atroseptica (now reclassified as Pectobacterium atrosepticum) is a gram-negative plant pathogenic bacterium primarily known for causing blackleg disease in potatoes. This soft-rot Erwinia species has significant agricultural and economic importance due to its devastating effects on crop production. Unlike its close relative Erwinia carotovora subspecies carotovora, which has a broader host range, E. carotovora subsp. atroseptica is more specialized and predominantly affects potato crops in temperate regions .

The pathogenicity of E. carotovora subsp. atroseptica stems primarily from its production of extracellular plant-cell-wall-degrading enzymes, which facilitate bacterial invasion and colonization of plant tissues . These enzymes include pectinases, cellulases, and proteases that macerate plant tissues, resulting in the characteristic soft-rot symptoms. The bacterium's ability to survive in soil and plant material contributes to its persistence in agricultural environments, though interestingly, research has shown that E. carotovora subsp. atroseptica is typically not detected in fallow soils .

Environmental adaptability is a key feature of this bacterium, with specific genetic mechanisms enabling survival under varying conditions. Like other plant pathogens, E. carotovora subsp. atroseptica possesses sophisticated regulatory systems that control virulence factor expression in response to environmental cues, nutrient availability, and plant defense responses.

Taxonomic Position and Identification

E. carotovora subsp. atroseptica belongs to the family Enterobacteriaceae and is closely related to other enterobacteria. The taxonomic identification of this subspecies typically relies on biochemical characteristics, pathogenicity tests, and molecular methods. Traditional testing schemes can sometimes lead to ambiguous results, as some isolates may exhibit characters that do not strictly adhere to standard taxonomic definitions .

Genetic Characteristics and Evolution

The genome of E. carotovora subsp. atroseptica contains various genetic elements that contribute to its virulence and survival. Like other Erwinia species, it may harbor mobile genetic elements such as insertion sequences (IS elements) and transposons that play roles in genetic plasticity and adaptive evolution, similar to what has been observed in E. carotovora subsp. carotovora strain ATTn10 .

Structure and Characteristics of the ArnE Protein

The ArnE protein in E. carotovora subsp. atroseptica functions as a subunit of a flippase involved in lipopolysaccharide modification. While specific structural information for the E. carotovora subsp. atroseptica ArnE is limited, insights can be gained by examining homologous proteins from related bacteria.

Protein Structure and Domains

Based on data from homologous ArnE proteins like that of Klebsiella pneumoniae, the ArnE protein is typically a small membrane protein consisting of approximately 112 amino acids . As a membrane-embedded protein, it contains multiple transmembrane segments that anchor it within the bacterial inner membrane. The protein forms part of a specialized transport system that facilitates the movement of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across the bacterial membrane.

Functional Mechanisms of ArnE in Lipopolysaccharide Modification

The ArnE protein plays a crucial role in the modification of bacterial lipopolysaccharide (LPS), particularly through the incorporation of 4-amino-4-deoxy-L-arabinose (Ara4N) residues. This modification process is critical for altering the charge properties of the bacterial cell surface.

The Arn Pathway and ArnE's Role

The Arn pathway consists of several proteins working in concert to synthesize and transfer Ara4N to lipid A, the anchor component of LPS. Within this pathway, ArnE functions as a subunit of a flippase complex that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol from the cytoplasmic to the periplasmic leaflet of the inner membrane . This flipping mechanism is essential for making the Ara4N available for further processing and eventual incorporation into LPS.

Flippase Mechanism and Membrane Transport

Unlike P4-ATPases that utilize ATP hydrolysis, the energy coupling mechanism for ArnE-mediated transport remains less understood. The protein likely forms a transmembrane channel or pathway that facilitates the movement of the Ara4N-phosphoundecaprenol substrate across the hydrophobic core of the membrane.

Coordination with ArnT Transferase

Once the Ara4N-phosphoundecaprenol is flipped to the periplasmic side by the ArnE-containing flippase complex, the ArnT transferase catalyzes the transfer of the Ara4N moiety onto lipid A . This coordinated action between the flippase and transferase ensures the efficient modification of LPS with Ara4N residues. Research with chemically synthesized Ara4N derivatives has shown that ArnT has specific structural requirements for its substrates, suggesting a finely tuned interaction between the flippase output and transferase activity .

Role in Antibiotic Resistance and Bacterial Survival

The modification of LPS with Ara4N residues represents a significant mechanism of bacterial resistance to various antibiotics, particularly cationic antimicrobial peptides and aminoglycosides.

Mechanism of Resistance Through LPS Modification

The addition of Ara4N to lipid A reduces the negative charge of the bacterial outer membrane by neutralizing phosphate groups on LPS molecules . This charge reduction decreases the electrostatic attraction between cationic antimicrobial peptides and the bacterial surface, thereby reducing antibiotic binding and effectiveness. Consequently, bacteria with active Ara4N modification pathways, including functional ArnE, typically display enhanced resistance to multiple classes of antibiotics.

Regulation of arnE Expression

The expression of arnE and other genes in the Arn pathway is likely regulated in response to environmental conditions, particularly those that signal potential antibiotic exposure or membrane stress. While specific information on regulation in E. carotovora subsp. atroseptica is limited, studies in related bacteria suggest that two-component regulatory systems and stress-responsive transcription factors may control arnE expression.

The RpoS sigma factor, known to regulate stress responses in E. carotovora subsp. carotovora, may indirectly influence the expression of membrane modification genes including those in the Arn pathway . This regulation would integrate the Ara4N modification system within the broader stress response network of the bacterium.

Recombinant Production and Research Applications

The study of ArnE and related proteins often requires recombinant production to obtain sufficient quantities for biochemical and structural analyses.

Expression Systems and Production Strategies

Recombinant ArnE from E. carotovora subsp. atroseptica can be produced using similar approaches to those employed for other membrane proteins. Based on established methods for homologous proteins, effective expression typically involves:

Expression HostAdvantagesChallenges
E. coliWell-established systems, high yieldPotential toxicity, inclusion body formation
Cell-free systemsAvoids toxicity issues, direct membrane incorporationLower yields, higher cost
Yeast expressionPost-translational processing, eukaryotic membraneDifferent membrane composition

The addition of affinity tags, such as polyhistidine (His) tags, facilitates purification while maintaining protein function . For membrane proteins like ArnE, detergent solubilization is typically required during purification, with detergents like LMNG (lauryl maltose neopentyl glycol) proving effective for related membrane proteins .

Applications in Research and Biotechnology

Recombinant ArnE proteins serve various research purposes:

  1. Structural studies to elucidate the molecular architecture of flippase complexes

  2. Functional assays to assess substrate specificity and transport kinetics

  3. Inhibitor screening to identify potential antimicrobial compounds targeting the Arn pathway

  4. Immunological studies to evaluate ArnE as a potential vaccine component or diagnostic marker

The development of specific inhibitors targeting ArnE could potentially restore antibiotic sensitivity in resistant bacterial strains, offering new approaches to combat antibiotic resistance.

Future Research Directions and Challenges

Despite its importance in bacterial physiology and antibiotic resistance, several aspects of ArnE function and structure remain to be fully elucidated.

Functional Assays Development

The development of robust functional assays for ArnE activity would accelerate research into this protein's mechanism. Approaches similar to those used for studying Ara4N transfer by ArnT, involving synthetic substrates and sensitive detection methods like mass spectrometry , could be adapted for investigating ArnE function.

Potential for Agricultural and Medical Applications

Understanding ArnE in E. carotovora subsp. atroseptica could have implications for controlling blackleg disease in potatoes and other plant diseases caused by related bacteria. Additionally, insights gained from studying bacterial flippases may inform research on eukaryotic phospholipid flippases, which play roles in membrane organization and signaling.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnE; ECA3141; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
arnE
Target Protein Sequence
MSYLLVAIVCLLTSLGQLCQKQAAECWRRLPVAQRQRVTFGWLMLAALLLGIGLLLWLLV LQHLPLGVAYPLLSINFVLVTLLAHYGFGERVDRHHWWGIALIVIGIYLMQGE
Uniprot No.

Target Background

Function

This protein functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit (ArnE). It translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasm.

Database Links

KEGG: eca:ECA3141

STRING: 218491.ECA3141

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.