Recombinant Erwinia carotovora subsp. atroseptica Probable intracellular septation protein A (ECA2313)

What are the key structural characteristics of ECA2313?

ECA2313 has a complete amino acid sequence of: MKQLLDFIPLVVFFAAYKLYDIYIASGALIAATALSLVVTWVMYRKIEKMTLVTFAMVVIFGSLTLVFHNDLFIKWKVTIIYGLFAVALLVSQFVMKQTLIQKMLGKELTLPQPVWGKLNFAWAMFFLVCGLVNIYIAFWLPQSVWVNFKVFGLTGVTLLFTLICGVYIYRHLPNDQEKSEEEKSEQP .

Structural analysis reveals:

• Multiple transmembrane domains as indicated by the hydrophobic amino acid stretches

• A signal sequence at the N-terminus (MKQLLDFIPLVVFFAAYK)

• Predicted membrane topology with both intracellular and extracellular domains

• Secondary structure prediction showing alpha-helical regions consistent with membrane proteins

The protein's structure suggests it likely spans the cell membrane multiple times, positioning it ideally for functions in cell division and septum formation.

How is the ECA2313 gene organized and regulated in the bacterial genome?

The ECA2313 gene is identified by its ordered locus name in the Erwinia carotovora subsp. atroseptica genome. While specific regulatory mechanisms for ECA2313 have not been fully characterized in the provided research, comparative genomic analyses suggest that:

• The gene likely exists within an operon containing other cell division-related genes

• Expression is presumably regulated in coordination with the bacterial cell cycle

• Transcriptional regulation may involve general stress response mechanisms similar to other septation proteins

• Regulatory elements might include SOS response boxes, as seen in some bacterial septation genes

To definitively establish the regulatory framework, researchers should consider RNA-seq analysis under various growth conditions and targeted promoter studies using reporter gene fusions.

What are the optimal conditions for expressing recombinant ECA2313?

Based on protocols established for similar membrane proteins, the following expression conditions are recommended:

The expressed protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage. Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week .

How can Erwinia carotovora be effectively transformed for ECA2313 studies?

Transformation of Erwinia carotovora requires specialized protocols due to its recalcitrance to standard transformation methods. A modified Hanahan method has been demonstrated to be effective, yielding transformation frequencies between 1 × 10² to 4 × 10⁴ colonies per microgram of plasmid DNA .

The optimized transformation protocol involves:

• Growing cells to early log phase (OD₆₀₀ of 0.4-0.6)

• Harvesting and washing cells in ice-cold CaCl₂ solution

• Preparing competent cells with extended incubation in CaCl₂ solution containing DMSO

• Heat-shock transformation at 42°C for 90 seconds

• Recovery in SOC medium for 1-2 hours before plating

For genetic manipulation studies, ColE1-based plasmids such as pBR322, pBR325, and pAT153 have been successfully used as cloning vectors . These vectors are particularly useful for studying genes involved in pathogenesis mechanisms, including those potentially related to ECA2313 function.

What techniques are most effective for localizing ECA2313 within bacterial cells?

To accurately determine the subcellular localization of ECA2313, the following complementary approaches are recommended:

• Fluorescent protein fusion imaging:

  • C-terminal or internal GFP/mCherry fusions (avoiding disruption of transmembrane domains)

  • Time-lapse microscopy to track protein movement during cell division

• Immunofluorescence microscopy:

  • Generation of specific antibodies against purified ECA2313

  • Fixed cell preparations with membrane permeabilization

  • Co-staining with nucleoid markers (DAPI) and membrane dyes

• Fractionation and Western blotting:

  • Careful separation of cytoplasmic, periplasmic, and membrane fractions

  • Western blot analysis using specific antibodies

  • Quantitative comparison between fractions

• Cryo-electron microscopy:

  • High-resolution imaging of protein complexes in native state

  • Visualization of septation machinery during cell division

These techniques can be complemented with nucleoid staining methods to visualize the relationship between ECA2313 localization and DNA segregation during cell division, similar to approaches used for studying E. coli division proteins .

How does ECA2313 contribute to bacterial cell division and septation?

While direct experimental evidence specific to ECA2313 is limited in the provided research, comparative analysis with homologous proteins suggests that ECA2313 likely functions in:

• Septal ring assembly: Participating in the formation of the division apparatus at the mid-cell position

• Membrane invagination: Facilitating the inward growth of the cell membrane during division

• Peptidoglycan synthesis coordination: Linking cytoplasmic division signals to cell wall synthesis machinery

• Division symmetry maintenance: Ensuring proper distribution of cellular components between daughter cells

This predicted functional role is supported by the protein's multiple transmembrane domains and its classification as a septation protein. For experimental validation, researchers should consider:

• Constructing conditional knockout strains to observe division defects

• Fluorescent tagging to monitor localization during the cell cycle

• Interaction studies with known division proteins (FtsZ, FtsA, etc.)

• Complementation studies in related bacteria with characterized septation mutants

These approaches would establish whether ECA2313 is essential for normal cell division and determine its specific role in the septation process.

What is the relationship between ECA2313 and bacterial pathogenesis?

As a member of the Erwinia carotovora (Pectobacterium atrosepticum) proteome, ECA2313 exists within a bacterial context important for plant pathogenesis. While not directly identified as a virulence factor in the provided research, several aspects warrant investigation:

• Cell division proteins can indirectly affect pathogenicity by influencing:

  • Bacterial growth rates during infection

  • Adaptation to stress conditions within the host environment

  • Cell morphology changes that may affect host interactions

• Potential research approaches include:

  • Virulence assays using knockout mutants in plant models

  • Expression analysis during different stages of infection

  • Comparative proteomics between pathogenic and non-pathogenic conditions

In related bacterial pathogens, intracellular proteins have shown altered expression patterns when bacteria transition from extracellular to intracellular environments . Similar adaptation might occur in E. carotovora during plant infection, potentially involving changes in septation protein expression or activity.

How is ECA2313 affected by environmental stress conditions?

Environmental factors likely influence ECA2313 expression and function, particularly under stress conditions encountered during host infection. Based on studies of other bacterial systems, the following responses might be expected:

The glidarc discharge studies on E. carotovora demonstrate significant effects on bacterial membrane proteins and DNA integrity under stress conditions . Similar approaches could be adapted to study ECA2313 response to various stressors, providing insights into its role during environmental adaptation and pathogenesis.

What protein-protein interactions is ECA2313 likely to participate in?

As a probable septation protein, ECA2313 likely participates in a complex network of protein-protein interactions essential for cell division. Potential interaction partners include:

• Core divisome components:

  • FtsZ (the bacterial tubulin homolog forming the Z-ring)

  • FtsA and ZipA (membrane tethers for FtsZ)

  • FtsK, FtsQ, FtsL, and FtsB (later divisome assembly components)

• Peptidoglycan synthesis machinery:

  • PBPs (Penicillin Binding Proteins)

  • MurG and other peptidoglycan precursor synthesis enzymes

• Regulatory proteins:

  • MinCDE system components (division site selection)

  • Nucleoid occlusion proteins

To experimentally identify these interactions, researchers should consider:

• Bacterial two-hybrid screening

• Co-immunoprecipitation followed by mass spectrometry

• Fluorescence resonance energy transfer (FRET) with candidate partners

• Crosslinking studies followed by pull-down assays

Establishing the interaction network would provide crucial insights into ECA2313's specific role in the division process.

How might targeting ECA2313 affect bacterial viability and plant pathogenesis?

Given its predicted role in cell division, ECA2313 represents a potential target for controlling E. carotovora infections. Researchers should consider:

• Conditional knockout studies:

  • Construction of depletion strains to determine essentiality

  • Growth curve analysis under various conditions

  • Competition assays between wild-type and mutant strains

• Inhibitor development considerations:

  • Identification of functional domains critical for activity

  • High-throughput screening for small molecule inhibitors

  • Structure-based drug design if crystal structure becomes available

• Plant infection models:

  • Virulence assessment of ECA2313-depleted strains

  • Plant tissue colonization efficiency measurements

  • Survival analysis under plant defense response conditions

The impact of targeting this protein would depend on whether it is essential for growth or specifically required during infection. Studies of septation protein inhibitors in other bacteria suggest that such approaches can effectively reduce bacterial viability and potentially limit pathogenesis.

What technical challenges should be anticipated when working with ECA2313?

Researchers working with ECA2313 should be prepared to address several technical challenges:

• Protein solubility issues:

  • As a membrane protein, ECA2313 presents solubility challenges

  • Consider detergent screening (DDM, LDAO, etc.) for optimal solubilization

  • Fusion partners (MBP, SUMO) may improve solubility

• Functional assay limitations:

  • Direct activity assays for septation proteins are often challenging

  • Consider indirect approaches (protein-protein interactions, localization)

  • Cell-based assays may be more informative than in vitro approaches

• Expression optimization:

  • Membrane proteins often show toxicity when overexpressed

  • Explore inducible systems with tight regulation

  • Consider expression in membrane protein-optimized strains (C41, C43)

• Structural analysis difficulties:

  • Membrane proteins present challenges for crystallization

  • Consider alternative approaches (cryo-EM, NMR of specific domains)

  • Computational modeling based on homologs may provide initial insights

The storage recommendations for recombinant ECA2313 (Tris-based buffer with 50% glycerol at -20°C or -80°C) highlight the stability considerations necessary when working with this protein .

How might systems biology approaches enhance our understanding of ECA2313?

Integrative systems biology approaches offer powerful tools for understanding ECA2313 in its broader cellular context:

• Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Identify co-regulated genes and proteins under various conditions

  • Map ECA2313 to specific cellular pathways and regulatory networks

• Network analysis:

  • Construct protein-protein interaction networks centered on ECA2313

  • Identify hub proteins and signaling cascades connected to septation

  • Compare network architecture across related bacterial species

• Computational modeling:

  • Develop predictive models of bacterial division incorporating ECA2313

  • Simulate the effects of protein depletion or mutation on division dynamics

  • Integrate with whole-cell models to predict systemic effects

• Single-cell analysis technologies:

  • Apply microfluidics and single-cell imaging to track division events

  • Correlate ECA2313 localization with specific division stages

  • Measure cell-to-cell variability in protein expression and function

These approaches would place ECA2313 within its broader functional context and help identify unexpected connections to other cellular processes beyond septation.

What evolutionary insights might be gained from comparative analysis of ECA2313 across bacterial species?

Evolutionary analysis of ECA2313 and its homologs across bacterial species could reveal:

• Conservation patterns:

  • Identification of highly conserved domains suggesting functional importance

  • Variability in non-essential regions that might reflect species-specific adaptations

  • Correlation between conservation and essentiality across diverse bacteria

• Phylogenetic relationships:

  • Construction of phylogenetic trees based on septation protein sequences

  • Comparison with species phylogeny to identify potential horizontal gene transfer events

  • Dating of evolutionary events in septation machinery development

• Structural adaptations:

  • Correlation between protein sequence changes and bacterial cell morphology

  • Identification of species-specific insertions or deletions with functional significance

  • Prediction of co-evolution with interacting proteins

This evolutionary perspective would provide context for understanding ECA2313's specific role in E. carotovora and might suggest strategies for developing species-specific targeting approaches.