Recombinant Erwinia carotovora subsp. atroseptica Probable ubiquinone biosynthesis protein UbiB (ubiB)

What is UbiB protein and what is its role in Erwinia carotovora?

UbiB (UniProt ID: Q6DAQ5) is a probable ubiquinone biosynthesis protein found in Erwinia carotovora subsp. atroseptica (also known as Pectobacterium atrosepticum). It is encoded by the ubiB gene (synonym: aarF), with the ordered locus name ECA0198. This protein plays a critical role in the biosynthesis of ubiquinone (Coenzyme Q), which functions as an essential electron carrier in aerobic respiration . The full-length protein consists of 546 amino acids and participates in the complex metabolic pathway that leads to ubiquinone production, which is crucial for bacterial energy metabolism and survival.

How should recombinant UbiB protein be stored for optimal stability?

Recombinant UbiB protein should be stored at -20°C for standard use, or at -80°C for extended storage periods. The protein is typically provided in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein . For working experiments, it is recommended to prepare aliquots to be stored at 4°C for no more than one week to maintain activity. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and functionality. When handling the protein, temperature fluctuations should be minimized to prevent degradation.

What are the key structural features of UbiB protein?

The UbiB protein from Erwinia carotovora contains specific structural domains that are essential for its function in ubiquinone biosynthesis. While the complete three-dimensional structure is not fully elucidated, sequence analysis reveals conserved motifs typical of the UbiB family. The protein is expected to contain transmembrane domains, as suggested by its amino acid sequence: "SRYLLGIGATLLIGGTLLLISRVEADMVPTGLIAAGIVAWII" . This hydrophobic region likely anchors the protein to the membrane, positioning it appropriately for its role in the ubiquinone biosynthetic pathway. Additionally, UbiB contains functional motifs that are involved in cofactor binding and catalytic activity.

What are the optimal expression conditions for recombinant UbiB protein?

Based on similar recombinant protein expression studies with Erwinia carotovora proteins, the following methodology is recommended:

• Select an appropriate E. coli expression strain (BL21(DE3) or derivatives) transformed with a plasmid containing the ubiB gene under an inducible promoter.

• Grow cultures in LB medium supplemented with the appropriate antibiotic at 37°C until reaching an OD600 of 0.4-0.6.

• Induce protein expression with 1 mM IPTG.

• Continue cultivation at a reduced temperature (16-25°C) for 16-18 hours to enhance soluble protein production.

• Harvest cells by centrifugation and proceed with protein extraction .

This approach has yielded successful results with other recombinant proteins from Erwinia carotovora and may need optimization specifically for UbiB production.

How can I design factorial experiments to study UbiB function under varying oxygen conditions?

When designing factorial experiments to study UbiB function across oxygen gradients, consider the following approach:

• Experimental Factors:

  • Oxygen concentration (anaerobic, microaerobic, aerobic conditions)

  • Growth phase (exponential vs. stationary)

  • Temperature variations (relevant to pathogen survival)

  • Genetic background (wild-type vs. ubiB mutants)

• Key Design Considerations:

  • Ensure balanced replication across all factor combinations

  • Include appropriate controls for each condition

  • Control for batch effects by randomizing sample processing

  • Consider blocking designs to minimize technical variation3

• Data Collection Points:

  • Monitor ubiquinone production (by HPLC)

  • Measure gene expression (RT-qPCR)

  • Assess bacterial growth rates

  • Determine protein expression levels

A well-designed factorial experiment will help elucidate the interaction between UbiB function and oxygen availability, providing insights into how this protein contributes to bacterial adaptation across oxygen gradients.

What purification strategy should be employed for recombinant UbiB protein?

A multi-step purification strategy is recommended for obtaining high-purity recombinant UbiB protein:

• Cell Lysis: Disrupt E. coli cells using sonication or high-pressure homogenization in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors.

• Initial Capture: If the recombinant protein contains an affinity tag, use the appropriate affinity chromatography (e.g., Ni-NTA for His-tagged proteins).

• Intermediate Purification: Apply ion-exchange chromatography to separate the protein based on charge properties.

• Polishing Step: Size exclusion chromatography to remove aggregates and ensure homogeneity.

• Buffer Exchange: Dialyze the purified protein into a storage buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 50% glycerol .

This sequential approach has proven effective for similar proteins and should yield UbiB protein of sufficient purity for subsequent functional and structural studies.

How does UbiB interact with other components of the O2-independent ubiquinone biosynthesis pathway?

UbiB appears to be part of a complex involving multiple proteins in the ubiquinone biosynthesis pathway. Recent research has identified a novel O2-independent pathway involving UbiT, UbiU, and UbiV proteins. While UbiB's exact role in relation to these components is still being investigated, several key interactions have been observed:

• UbiT contains an SCP2 lipid-binding domain and likely functions as an accessory factor in the pathway.

• UbiU and UbiV form a heterodimer complex, with each protein binding a 4Fe-4S cluster via conserved cysteine residues that are essential for their hydroxylase activity.

• UbiB may coordinate with these components to facilitate ubiquinone biosynthesis under varying oxygen conditions .

The O2-independent pathway enables bacteria to synthesize ubiquinone across the entire O2 range, which is particularly important for pathogenic bacteria that encounter varying oxygen levels during infection. Understanding UbiB's interaction with these pathway components could provide insights into bacterial adaptation mechanisms and potential therapeutic targets.

What techniques can be employed to analyze the kinetics of UbiB-mediated reactions?

Several sophisticated methodologies can be applied to analyze the kinetics of UbiB-mediated reactions:

• Isothermal Titration Calorimetry (ITC):
  ITC provides direct measurement of heat released or absorbed during biochemical reactions, allowing determination of binding constants, reaction stoichiometry, and thermodynamic parameters. Similar approaches have been successfully applied to other Erwinia carotovora enzymes .

• Oxygen Consumption Assays:
  Using oxygen electrodes to measure oxygen consumption rates in reactions containing UbiB and its substrates can provide insights into reaction kinetics under varying conditions.

• LC-MS/MS Analysis:
  For monitoring substrate consumption and product formation over time, which allows for detailed kinetic parameter determination.

• Spectrophotometric Assays:
  Continuous monitoring of cofactor (NAD(P)H) oxidation or reduction can indirectly track UbiB activity.

• EPR Spectroscopy:
  Particularly useful if UbiB utilizes iron-sulfur clusters or other paramagnetic centers during catalysis, similar to UbiU and UbiV proteins .

These methods can be combined to create a comprehensive kinetic profile of UbiB activity under varying conditions, providing insights into its catalytic mechanism and regulation.

What are the challenges in studying the membrane association of UbiB protein?

Studying membrane-associated proteins like UbiB presents several technical challenges:

• Extraction and Solubilization:

  • Identification of suitable detergents that maintain protein structure and activity

  • Risk of protein aggregation during purification

  • Difficulty in obtaining sufficient quantities of functional protein

• Structural Analysis:

  • Traditional crystallography approaches are challenging with membrane proteins

  • Need for alternative structural determination methods such as cryo-EM

  • Requirement for membrane mimetics (nanodiscs, liposomes) for functional studies

• Functional Reconstitution:

  • Establishing proper lipid composition for optimal activity

  • Determining correct orientation in reconstituted systems

  • Maintaining native interactions with other pathway components

• Analytical Considerations:

  • Interference of detergents with many biochemical assays

  • Background signals from lipids in mass spectrometry

  • Complexity of distinguishing specific from non-specific interactions

These challenges can be addressed through careful experimental design, including screening multiple detergents, employing contemporary structural biology approaches, and developing specialized activity assays tailored to membrane-associated proteins.

How does UbiB from Erwinia carotovora compare to homologous proteins in other bacterial species?

UbiB from Erwinia carotovora shares significant sequence and functional homology with proteins from other bacterial species, particularly within Proteobacteria. Comparative analysis reveals:

This evolutionary conservation underscores the critical role of UbiB in bacterial metabolism across diverse ecological niches. The variations observed in specific regions may reflect adaptations to particular environmental conditions or metabolic requirements of each species .

What is the evolutionary relationship between UbiB and the O2-independent ubiquinone biosynthesis components?

The evolutionary history of UbiB and the recently discovered O2-independent ubiquinone biosynthesis components (UbiT, UbiU, and UbiV) reveals interesting patterns of co-evolution and adaptation:

• Phylogenetic analyses indicate that UbiB-like proteins emerged earlier in bacterial evolution than the specialized O2-independent pathway components.

• The UbiU-UbiV system likely evolved as an adaptation to fluctuating oxygen environments, allowing bacteria to synthesize ubiquinone under anaerobic conditions.

• Distribution analysis shows that while UbiB is widely conserved across diverse bacterial phyla, the UbiT, UbiU, and UbiV proteins are predominantly found in alpha-, beta-, and gammaproteobacterial clades, including several human pathogens .

• This differential distribution suggests that the O2-independent pathway represents a specialized adaptation in certain bacterial lineages, potentially providing a competitive advantage in environments with variable oxygen availability.

• The co-occurrence of both pathways in many proteobacteria indicates selective pressure to maintain ubiquinone production across the entire oxygen spectrum.

This evolutionary perspective provides insights into bacterial adaptation strategies and highlights potential targets for developing species-specific antimicrobial approaches.

What are common issues in recombinant UbiB protein expression and how can they be resolved?

Researchers working with recombinant UbiB protein may encounter several common challenges:

• Low Expression Levels:

  • Issue: Poor yields of UbiB protein despite optimal induction conditions.

  • Solution: Optimize codon usage for the expression host, reduce culture temperature post-induction (16-20°C), and consider using stronger promoters or specialized expression strains.

• Inclusion Body Formation:

  • Issue: Expression results in insoluble aggregates.

  • Solution: Reduce induction temperature, decrease IPTG concentration (0.1-0.5 mM instead of 1 mM), co-express with molecular chaperones, or add solubilizing agents like arginine or proline to the growth medium .

• Protein Degradation:

  • Issue: Significant proteolysis during expression or purification.

  • Solution: Use protease-deficient host strains, include additional protease inhibitors, and minimize the time between cell harvest and protein purification.

• Loss of Activity:

  • Issue: Purified protein shows little or no enzymatic activity.

  • Solution: Ensure proper folding by optimizing buffer conditions, include potential cofactors during purification, and verify that the protein is in the appropriate oxidation state.

Methodical optimization of these parameters has been successful for related proteins from Erwinia carotovora and should be adaptable to UbiB expression .

How can functional assays for UbiB be designed to address data inconsistencies?

When developing functional assays for UbiB and encountering inconsistent results, consider these methodological approaches:

• Establish Clear Positive and Negative Controls:

  • Use well-characterized proteins with known activity levels as positive controls

  • Include heat-inactivated UbiB and reaction mixtures lacking essential components as negative controls

• Implement Multi-Parameter Measurement:

  • Simultaneously monitor several reaction parameters (substrate consumption, product formation, cofactor redox state)

  • Use complementary analytical techniques (spectroscopy, chromatography, mass spectrometry) to validate results

• Systematic Variation of Reaction Conditions:

  • Create a matrix of conditions varying pH, temperature, ionic strength, and cofactor concentrations

  • Determine the robustness of the assay across this condition space

• Statistical Design and Analysis:

  • Employ factorial experimental designs to identify significant variables and interactions

  • Use statistical tools to identify outliers and sources of variation

  • Implement adequate technical and biological replicates (minimum n=3 for each condition)3

• Data Validation Strategy:

  Validation Approach	Implementation	Expected Outcome
  Technical Replication	Repeat measurements on same sample	Assess measurement precision
  Biological Replication	Independent protein preparations	Evaluate preparation consistency
  Method Triangulation	Different analytical techniques	Confirm results across platforms
  Dose-Response Analysis	Varying substrate concentrations	Establish Michaelis-Menten kinetics
  Time-Course Studies	Multiple time points	Confirm reaction linearity and completion

This comprehensive approach allows researchers to identify sources of variability and develop robust, reproducible assays for UbiB functional characterization.

What are promising research areas regarding UbiB's role in bacterial adaptation to oxygen stress?

Several promising research directions could elucidate UbiB's role in bacterial adaptation to oxygen stress:

• Comparative Transcriptomics:
  Investigate gene expression profiles of wild-type and ubiB mutant strains under various oxygen conditions to identify regulatory networks and compensation mechanisms.

• Protein-Protein Interaction Studies:
  Employ techniques such as crosslinking mass spectrometry or proximity labeling to identify UbiB's interaction partners under varying oxygen concentrations, particularly focusing on potential interactions with UbiT, UbiU, and UbiV proteins .

• In vivo Imaging:
  Develop fluorescently tagged UbiB variants to track its subcellular localization and dynamics in response to changing oxygen levels.

• Metabolic Flux Analysis:
  Use isotope-labeled precursors to trace the metabolic flux through ubiquinone biosynthesis pathways under aerobic versus anaerobic conditions.

• Structural Studies:
  Determine the three-dimensional structure of UbiB in different redox states to understand its mechanism of action and potential conformational changes under varying oxygen conditions.

These approaches would provide comprehensive insights into how UbiB contributes to bacterial adaptation across oxygen gradients, with potential implications for understanding pathogen persistence in host environments.

How might advances in structural biology techniques contribute to understanding UbiB function?

Recent advances in structural biology offer exciting opportunities to elucidate UbiB function:

• Cryo-Electron Microscopy (Cryo-EM):
  With improvements in resolution, cryo-EM can now determine structures of membrane proteins without crystallization, potentially revealing UbiB's membrane association and interaction with pathway components.

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
  This technique can identify flexible regions and conformational changes in UbiB under different conditions, providing insights into protein dynamics during catalysis.

• Integrative Structural Modeling:
  Combining multiple experimental data sources (crosslinking, small-angle X-ray scattering, NMR) with computational modeling to generate comprehensive structural models of UbiB within its functional context.

• Time-Resolved Structural Methods:
  Emerging techniques like time-resolved X-ray crystallography and time-resolved cryo-EM could capture UbiB in different catalytic states, revealing the mechanism of its enzymatic activity.

• In-Cell Structural Biology:
  Methods to determine protein structures within cells could reveal how UbiB functions in its native cellular environment, including its interactions with the membrane and other proteins.

These structural insights would significantly advance our understanding of UbiB's role in ubiquinone biosynthesis and potentially identify specific regions for targeted studies or therapeutic development.

How does understanding UbiB function contribute to broader knowledge of bacterial metabolism?

Research on UbiB provides valuable insights that extend beyond ubiquinone biosynthesis to broader aspects of bacterial metabolism:

• UbiB's role in the ubiquinone biosynthesis pathway illuminates how bacteria maintain respiratory electron transport chain function across varying environmental conditions.

• The interplay between O2-dependent and O2-independent pathways demonstrates bacterial metabolic flexibility, a critical factor in adaptation to changing environments .

• Understanding UbiB contributes to knowledge of how bacteria optimize energy production efficiency, particularly during transitions between aerobic and anaerobic conditions.

• The conservation of UbiB across diverse bacterial species suggests its fundamental importance in cellular bioenergetics throughout bacterial evolution.

• As a membrane-associated protein involved in a critical metabolic pathway, UbiB represents an important model for studying how membrane proteins contribute to cellular metabolism and adaptation.

This comprehensive understanding of UbiB function provides a foundation for diverse applications, from developing new antimicrobial strategies to engineering bacterial strains with enhanced metabolic capabilities for biotechnological applications.

What methodological approaches can integrate UbiB research with systems biology perspectives?

Integrating UbiB research with systems biology requires sophisticated methodological approaches:

• Multi-Omics Integration:
  Combine transcriptomics, proteomics, and metabolomics data to place UbiB function within the context of global cellular responses to oxygen availability.

• Genome-Scale Metabolic Modeling:
  Incorporate UbiB-mediated reactions into genome-scale metabolic models to predict the system-wide effects of UbiB modulation under different conditions.

• Network Analysis:
  Map UbiB's position within protein-protein interaction networks and metabolic pathways to identify potential regulatory hubs and feedback mechanisms.

• Synthetic Biology Approaches:
  Design minimal ubiquinone production systems with defined components to understand the essential elements and regulatory circuits involved.

• Comparative Systems Analysis:
  Study UbiB function across multiple bacterial species to identify conserved network motifs versus species-specific adaptations.

• Machine Learning Applications: Employ machine learning algorithms to identify patterns in large-scale datasets that may reveal novel insights about UbiB function and regulation.