Recombinant Erwinia carotovora subsp. atroseptica Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

Lgt enzymes, including those in Erwinia spp., share conserved features:

  • Substrate Specificity: Transfers sn-1,2-diacylglyceryl groups to the α-amino group of cysteine +1 in prolipoproteins .

  • Membrane Topology: Conserved seven transmembrane segments, with the N-terminus facing the periplasm and the C-terminus in the cytoplasm .

  • Critical Residues: Y26, N146, and G154 are essential for activity, while R143, E151, R239, and E243 are important .

Recombinant Production in E. coli

E. coli is a common host for recombinant Lgt production due to its efficient protein expression systems. For Erwinia carotovora Lgt, hypothetical production strategies would mirror methods used for related enzymes:

ParameterE. coli Production Strategy for Erwinia LgtSupporting Data
Plasmid VectorspET30a(+), pET-28a for His-tagged proteins
Induction ConditionsIPTG induction at 30°C for optimal solubility
PurificationAffinity chromatography (e.g., Ni-NTA)
Yield~0.9 g/L soluble protein (analogous to ErAII)

Comparative Analysis with Other Lgt Enzymes

While E. carotovora subsp. atroseptica Lgt data are sparse, comparisons with E. coli and Thermus thermophilus Lgt reveal conserved features:

OrganismMembrane SegmentsEssential ResiduesEnzymatic ActivityReferences
E. coli7Y26, N146, G154Diacylglycerol transfer
Thermus thermophilus7Signature motifHigh thermostability
Erwinia carotovora (hyp.)7 (inferred)Similar to E. coliLipoprotein maturation

Potential Applications and Challenges

  • Antibacterial Target: Lgt inhibition disrupts lipoprotein biosynthesis, leading to bacterial growth inhibition .

  • Therapeutic Relevance: Erwinia carotovora enzymes (e.g., L-asparaginase II) are used in leukemia treatment, suggesting Lgt could be a novel target .

  • Challenges: Limited structural data for Erwinia Lgt, unlike E. coli Lgt .

Research Gaps and Future Directions

  1. Structural Studies: X-ray crystallography or cryo-EM for Erwinia Lgt to identify subspecies-specific motifs.

  2. Inhibitor Development: Screening for small-molecule inhibitors targeting the Lgt signature motif .

  3. Host-Specific Pathogenicity: Linking Lgt activity to E. carotovora subsp. atroseptica virulence in plants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please specify them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
lgt; ECA0987; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
lgt
Target Protein Sequence
MMTTSYLAFPQFDPVIFSIGPLALHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKDEVEN LLYMGFLGVFVGGRLGYVLFYAFPSFLENPLYLFKVWDGGMSFHGGLMGVICVMLWFAHR TKRHFFQVADFIAPLIPFGLGAGRLGNFINGELWGRVTTDTPWAMLFPGSRSEDMMLAVS NPQWQTIFNQFGMLPRHPSQLYQMMLEGVALFIILNLFIRKSRPMGSVSGLFLICYGMFR IITEFFRQPDAQLGLFGGLFSMGQILSLPMVLAGILMMVWAYRRQPAQQ
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: eca:ECA0987

STRING: 218491.ECA0987

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is a conserved bacterial enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins, which are crucial components for bacterial growth and pathogenesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox of prolipoproteins, forming a thioether bond . This modification is the initial and critical step in a sequential pathway of lipoprotein processing that ultimately results in properly localized and functional lipoproteins in the bacterial cell envelope . The reaction catalyzed by Lgt produces glycerol phosphate as a by-product, which has been utilized in biochemical assays to measure Lgt activity .

Lgt function is essential for maintaining bacterial cell envelope integrity, particularly in proteobacteria such as Escherichia coli and presumably in Erwinia carotovora as well. Studies have demonstrated that Lgt depletion leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics . Additionally, Lgt is involved in the proper processing of numerous lipoproteins that serve diverse functions in bacteria, including structural integrity, nutrient acquisition, and virulence factor secretion. The conservation of Lgt across bacterial species underscores its fundamental importance in bacterial physiology and survival .

The essentiality of Lgt has been conclusively demonstrated through genetic studies showing that Lgt depletion results in growth arrest and cell death, even in the absence of the major outer membrane lipoprotein Lpp . These findings validate the critical nature of Lgt-mediated lipoprotein processing for bacterial viability and highlight its potential as a target for antimicrobial development. The biochemical pathway involving Lgt represents a unique aspect of prokaryotic cellular processes without direct homologs in eukaryotic systems, making it an attractive candidate for selective inhibition strategies.

How can Lgt activity be measured biochemically in research settings?

Biochemical assessment of Lgt enzymatic activity typically involves measuring the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. One established method utilizes a coupled luciferase reaction to detect the released glycerol-3-phosphate (G3P) . In this assay system, researchers must account for the fact that when using phosphatidylglycerol containing a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) can be released as Lgt catalyzes the reaction . Typically, the peptide substrate is derived from a bacterial lipoprotein such as Pal (Peptidoglycan-associated lipoprotein), with a sequence containing the conserved cysteine that is modified by Lgt (e.g., Pal-IAAC) .

The specificity of the assay can be confirmed using control peptides where the conserved cysteine is mutated to alanine (e.g., Pal-IAAA), which should not serve as substrates for Lgt and thus show no activity in the assay . This control helps validate that the observed enzyme activity is specific to the Lgt-catalyzed reaction. For inhibitor screening purposes, researchers can measure the IC50 values of candidate molecules by conducting the enzymatic assay in the presence of varying concentrations of the test compounds. As demonstrated with inhibitors like G9066, G2823, and G2824, potent Lgt inhibitors show IC50 values in the submicromolar range (0.24 μM, 0.93 μM, and 0.18 μM, respectively) .

When establishing Lgt activity assays, it is critical to ensure proper solubilization and stability of the enzyme, as Lgt is a membrane protein. Detergents such as n-dodecyl β-D-maltoside (DDM) at 0.02% concentration have been successfully used to maintain Lgt in a functional state during biochemical studies . Additional considerations include optimizing reaction conditions such as pH, temperature, and divalent cation concentrations to maximize enzymatic activity while minimizing background signal. These biochemical assays provide valuable tools for both fundamental research into Lgt function and applied studies screening for potential Lgt inhibitors.

How does Lgt depletion affect bacterial cell envelope integrity and viability?

Lgt depletion has profound effects on bacterial cell envelope integrity and viability due to its critical role in lipoprotein processing. When Lgt is depleted, unprocessed prolipoproteins accumulate in the bacterial membrane, specifically the unmodified prolipoprotein form (UPLP) . This accumulation disrupts the normal architecture and function of the cell envelope, particularly the outer membrane in Gram-negative bacteria. Experimental evidence demonstrates that Lgt depletion in uropathogenic Escherichia coli leads to permeabilization of the outer membrane, rendering the bacteria more susceptible to serum killing and antibiotics . These findings indicate that proper Lgt function is essential for maintaining the permeability barrier function of the bacterial outer membrane.

Microscopic examination of bacteria undergoing Lgt depletion reveals distinctive morphological changes, including outer membrane blebbing and increased cell size . These phenotypes are similar to those observed in strains deficient in certain outer membrane lipoproteins, such as Pal-deficient E. coli strains, suggesting that the effects of Lgt depletion are mediated through impaired function of multiple lipoproteins . Furthermore, Lgt depletion affects the peptidoglycan association of lipoproteins like Lpp and Pal, which are critical for maintaining connections between the outer membrane and the peptidoglycan layer. Studies show that Lgt depletion leads to decreased peptidoglycan-associated forms of these lipoproteins, thereby weakening the structural integrity of the cell envelope .

The essentiality of Lgt persists even in the absence of Lpp, which is the most abundant lipoprotein in E. coli. Genetic studies have demonstrated that attempts to delete the lgt gene in strains lacking Lpp are unsuccessful, and depletion strains cannot survive without basal expression of Lgt . This indicates that other lipoproteins beyond Lpp play crucial roles in cellular viability that depend on Lgt processing. Growth analyses of Lgt depletion strains show that while deletion of lpp partially restores growth in early phases, the cells still exhibit abnormal morphology upon entry into stationary phase, when the percentage of Lpp cross-links to peptidoglycan typically increases . Collectively, these findings establish that Lgt function affects multiple aspects of bacterial physiology through its role in processing numerous essential lipoproteins involved in cell envelope structure and function.

What are the current approaches for developing Lgt inhibitors as potential antibiotics?

Development of Lgt inhibitors as potential antibiotics has advanced significantly with several innovative approaches yielding promising candidates. One successful strategy has employed affinity selection of macrocyclic peptides to identify molecules that bind specifically to Lgt . In this approach, researchers used biotinylated E. coli Lgt in the presence of detergent (0.02% n-dodecyl β-D-maltoside) to screen mRNA-peptide fusion libraries generated through in vitro translation systems . After multiple rounds of affinity maturation and off-rate selections to identify high-affinity binders, next-generation sequencing was used to characterize the enriched candidates . This methodology has successfully identified novel Lgt-binding macrocycles that demonstrate potent inhibition of Lgt enzymatic activity.

Biochemical validation of candidate inhibitors is typically performed using the glycerol phosphate release assay described earlier. Potent inhibitors such as G9066, G2823, and G2824 exhibit IC50 values in the submicromolar range (0.24 μM, 0.93 μM, and 0.18 μM, respectively), demonstrating effective inhibition of Lgt enzymatic function in vitro . To confirm on-target activity in bacterial cells, researchers employ multiple experimental approaches. These include detecting the accumulation of prolipoprotein intermediates by Western blot analysis, observing characteristic morphological changes such as outer membrane blebbing, and using CRISPRi technology to create sensitized strains with reduced Lgt expression . Specifically, bacteria with decreased expression of lgt show enhanced sensitivity to Lgt inhibitors but not to inhibitors targeting other steps in lipoprotein biosynthesis, confirming target specificity .

Another important aspect of inhibitor development involves addressing potential resistance mechanisms. Interestingly, unlike inhibitors of other lipoprotein biosynthesis steps, Lgt inhibitors appear less susceptible to common resistance mechanisms. For example, deletion of the major outer membrane lipoprotein lpp is not sufficient to rescue growth after Lgt depletion or to provide resistance to Lgt inhibitors . Additionally, researchers have been unable to raise on-target resistant mutants to Lgt inhibitors, suggesting that mutations that might disrupt inhibitor binding could also compromise essential Lgt function . This characteristic is similar to observations with globomycin analogs that target the signal peptidase II enzyme in the lipoprotein pathway, for which no on-target resistance mutations have been described . These findings highlight the potential advantages of Lgt inhibitors as antibacterial agents with potentially lower susceptibility to resistance development compared to other antibiotic classes.

What experimental methods are used to validate the specificity of Lgt inhibitors?

Validation of Lgt inhibitor specificity requires a multi-faceted experimental approach to confirm that bacterial growth inhibition is mediated specifically through Lgt inhibition rather than off-target effects. A primary method involves comparing the phenotypic effects of chemical inhibition with those observed in genetic depletion studies. Researchers have demonstrated that Lgt inhibitors produce the same characteristic effects as Lgt depletion, including accumulation of unprocessed prolipoproteins, outer membrane blebbing, increased cell size, and reduced peptidoglycan association of lipoproteins . This phenotypic concordance between chemical inhibition and genetic depletion provides strong evidence for on-target activity of the inhibitors.

Western blot analysis serves as a critical tool for detecting specific molecular consequences of Lgt inhibition. The accumulation of specific prolipoprotein intermediates can be visualized by fractionating bacterial cell lysates to separate SDS-insoluble peptidoglycan-associated proteins (PAP) from SDS-soluble non-peptidoglycan-associated proteins (non-PAP) . Using antibodies against lipoproteins such as Lpp and Pal, researchers can detect changes in the processing and localization of these proteins following Lgt inhibition. For instance, Lgt inhibition leads to decreased peptidoglycan-associated diacylglyceryl-modified pro-Lpp (DGPLP) and other peptidoglycan-linked Lpp forms, similar to what is observed in Lgt depletion strains .

A particularly powerful approach for validating inhibitor specificity utilizes CRISPRi technology to create strains with reduced expression of specific target genes. By decreasing the expression of lgt, lspA (encoding signal peptidase II), or lolC (a component of the Lol system for lipoprotein transport), researchers can generate bacteria with enhanced sensitivity to inhibitors targeting these specific proteins . In these experiments, bacteria with reduced lgt expression show specific sensitization to Lgt inhibitors but not to inhibitors of LspA or LolCDE . Conversely, bacteria with reduced lspA or lolC expression show enhanced sensitivity to inhibitors targeting these proteins. These differential sensitization patterns provide compelling evidence for the specificity of inhibitor action. Additional validation can come from performing structural studies to determine the binding mode of inhibitors to Lgt or from developing resistant mutants and characterizing the resistance mechanisms, although on-target resistance to Lgt inhibitors has proven difficult to generate .

How can recombinant Lgt be expressed and purified for structural and functional studies?

Expression and purification of recombinant Lgt presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. Based on established protocols for similar membrane proteins, researchers typically employ expression systems optimized for membrane protein production. E. coli is commonly used as an expression host, with constructs designed to include affinity tags (such as His-tag or biotin tag) to facilitate purification . The expression vectors often utilize inducible promoters (such as T7 or arabinose-inducible systems) to control expression levels, as excessive overexpression of membrane proteins can be toxic to the host cells. When working with Erwinia carotovora Lgt specifically, codon optimization for E. coli expression may be necessary to improve yields.

The purification process for Lgt requires careful solubilization using appropriate detergents. For E. coli Lgt, 0.02% n-dodecyl β-D-maltoside (DDM) has been successfully employed to maintain the protein in a functional state . The purification workflow typically involves cell lysis (often using mechanical disruption methods suitable for bacterial cells), membrane fraction isolation by ultracentrifugation, detergent solubilization of membrane proteins, and affinity chromatography using the incorporated affinity tag. For biotinylated Lgt, streptavidin-coated beads provide an effective capture method . Following initial capture, additional purification steps such as size exclusion chromatography may be employed to achieve higher purity.

Quality control of the purified Lgt is essential to ensure that the protein retains its native structure and enzymatic activity. Functional assessment can be performed using the glycerol phosphate release assay with synthetic peptide substrates derived from known lipoproteins . Additionally, thermal stability assays and circular dichroism spectroscopy can provide information about the structural integrity of the purified protein. For structural studies such as X-ray crystallography or cryo-electron microscopy, specialized detergents or lipid nanodiscs may be required to maintain protein stability while allowing for crystal formation or single-particle analysis. When purifying Lgt for inhibitor screening purposes, it is important to verify that the purification conditions do not interfere with the assay readout and that the protein remains stable throughout the screening process.

What genetic approaches can be used to study Lgt essentiality in bacteria?

Studying the essentiality of Lgt in bacteria requires sophisticated genetic approaches that allow for controlled depletion or conditional expression of the enzyme. One effective strategy involves the creation of inducible deletion strains, where the chromosomal lgt gene is deleted and replaced with an antibiotic resistance marker, while a complementing copy of lgt is provided on a plasmid under the control of an inducible promoter . In E. coli, arabinose-inducible promoters have been successfully employed for this purpose, allowing researchers to modulate Lgt expression by varying the arabinose concentration in the growth medium . By gradually reducing the inducer concentration, the effects of Lgt depletion on bacterial growth, morphology, and viability can be systematically studied.

Another genetic approach utilizes CRISPRi (CRISPR interference) technology to achieve titratable reduction in gene expression without complete deletion. This system employs a catalytically inactive Cas9 (dCas9) along with guide RNAs (gRNAs) targeting the gene of interest to reduce its transcription . The advantage of this approach is that it allows for partial downregulation of essential genes without requiring complementation systems. Studies have demonstrated that CRISPRi targeting of lgt leads to reduced Lgt expression, resulting in increased sensitivity to Lgt inhibitors . This technology also enables comparative studies of multiple genes in the lipoprotein biosynthesis pathway by targeting different genes with specific gRNAs.

To definitively demonstrate gene essentiality, attempted gene deletion approaches can provide conclusive evidence. For instance, researchers have shown that attempts to cure complementing plasmids from Δlgt strains using plasmid displacement systems like pFREE are unsuccessful, even in the absence of the major lipoprotein Lpp . Similarly, attempts to delete lgt by P1 transduction in an lpp mutant background fail, indicating that Lgt function is essential regardless of Lpp status . These genetic approaches can be complemented with biochemical analyses such as Western blotting to detect accumulated prolipoprotein intermediates and microscopic examination to observe morphological changes associated with Lgt depletion. Together, these methodologies provide a comprehensive toolkit for investigating the essentiality and physiological roles of Lgt in bacterial systems.

What screening methods are effective for identifying novel Lgt inhibitors?

Screening for novel Lgt inhibitors employs a combination of biochemical, biophysical, and cell-based approaches to identify compounds with specific activity against the target enzyme. One successful methodology involves affinity selection of macrocyclic peptides that bind specifically to the Lgt protein . This approach utilizes an mRNA-peptide fusion library generated through in vitro translation systems with reprogrammed genetic codes that incorporate non-canonical amino acids to enhance structural diversity . The screening process involves incubating the peptide library with biotinylated Lgt, capturing Lgt-binding peptides using streptavidin-coated beads, and performing multiple rounds of selection with increasing stringency to identify high-affinity binders . Following selection, next-generation sequencing is used to characterize the enriched candidates, which can then be synthesized and tested for inhibitory activity.

Biochemical screening approaches rely on the glycerol phosphate release assay to directly measure inhibition of Lgt enzymatic activity. In this assay system, the release of glycerol-3-phosphate is detected using a coupled luciferase reaction, allowing for quantitative assessment of enzyme inhibition . This methodology can be adapted to high-throughput formats using multi-well plates to screen large compound libraries. Compounds showing promising activity in primary screens are typically confirmed through dose-response studies to determine IC50 values, with potent inhibitors exhibiting submicromolar potency . The specificity of hits can be verified using control assays with mutant peptide substrates or with other enzymes in the lipoprotein biosynthesis pathway.

Cell-based screening approaches complement biochemical methods by identifying compounds with activity in bacterial systems. These screens typically measure bacterial growth inhibition using broth microdilution methods following Clinical and Laboratory Standards Institute (CLSI) guidelines . To enhance the specificity of cell-based screens, CRISPRi technology can be employed to generate strains with reduced Lgt expression, which should show enhanced sensitivity to Lgt inhibitors . This approach helps distinguish between compounds acting through Lgt inhibition versus other mechanisms. Following identification of promising candidates, validation studies include Western blot analysis to detect accumulated prolipoprotein intermediates, microscopic examination of morphological changes, and genetic sensitization experiments using strains with reduced expression of various lipoprotein biosynthesis enzymes . These comprehensive screening and validation approaches have successfully identified novel Lgt inhibitors with potent activity against both the isolated enzyme and intact bacterial cells.

What are the current challenges in developing Lgt inhibitors as antibiotics?

Development of Lgt inhibitors as clinically useful antibiotics faces several significant challenges despite the promising biochemical and microbiological data supporting Lgt as a valuable target. One primary challenge involves optimizing the physicochemical properties of inhibitors for effective penetration of the bacterial cell envelope, particularly in Gram-negative bacteria with their additional outer membrane barrier. The macrocyclic peptide inhibitors identified through affinity selection may require structural optimization to enhance membrane permeability while maintaining target binding affinity . Additionally, these compounds must demonstrate appropriate pharmacokinetic properties, including suitable half-life, volume of distribution, and clearance profiles, to achieve effective in vivo efficacy.

The translation from in vitro activity to in vivo efficacy represents another major hurdle in Lgt inhibitor development. While potent enzymatic inhibition and bactericidal activity have been demonstrated in laboratory settings, achieving sufficient exposure at the site of infection to eradicate bacterial pathogens in animal models and eventually in human patients requires additional optimization. Furthermore, the spectrum of activity across different bacterial species needs thorough characterization, as structural variations in Lgt between species might affect inhibitor binding and efficacy. Although Lgt is conserved across bacteria, subtle differences in protein structure or membrane environment could influence inhibitor interactions. Developing Lgt inhibitors with broad-spectrum activity against multiple clinically relevant pathogens would enhance their therapeutic potential but adds another layer of complexity to the optimization process.

How can potential resistance mechanisms to Lgt inhibitors be addressed?

Addressing potential resistance mechanisms to Lgt inhibitors requires a multifaceted approach that builds upon the unique characteristics of this antibacterial target. Interestingly, research has demonstrated that unlike inhibitors of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein lpp is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This finding suggests that Lgt inhibitors may have advantages regarding the development of resistance compared to other antibiotics. Additionally, researchers have been unable to raise on-target resistant mutants to Lgt inhibitors, potentially because mutations that might disrupt inhibitor binding could simultaneously compromise essential Lgt function . This characteristic is reminiscent of globomycin and its improved analog G0790, which bind to a highly conserved active site in signal peptidase II and for which no on-target resistance mutations have been described .

Despite these encouraging observations, proactive strategies to address potential resistance development remain crucial. One approach involves the development of combination therapies that simultaneously target multiple steps in bacterial cell envelope biogenesis. By combining Lgt inhibitors with molecules targeting other essential processes, such as peptidoglycan synthesis or outer membrane assembly, the likelihood of resistance development could be further reduced. The observed synergy between Lgt inhibition and increased sensitivity to serum killing and existing antibiotics suggests that Lgt inhibitors might serve as effective components in combination regimens . Additionally, targeting conserved binding sites or catalytic residues in Lgt that are essential for substrate recognition and enzymatic function could minimize the likelihood of mutations that confer resistance while preserving enzymatic activity.

Understanding the mechanistic basis of Lgt inhibition will also be critical for addressing potential resistance mechanisms. Structural studies to determine if inhibitors competitively block phosphatidylglycerol or prolipoprotein substrate binding would provide valuable insights for rational drug design . Such information could guide the development of inhibitors that interact with multiple critical sites on the enzyme, further reducing the probability of resistance-conferring mutations. Continuous surveillance for potential resistance mechanisms through laboratory evolution experiments and genomic analysis of clinical isolates will also be essential to identify and address any emerging resistance pathways. By combining these approaches—leveraging the inherent difficulties in developing resistance to Lgt inhibitors, employing combination therapies, targeting conserved essential sites, and conducting ongoing surveillance—researchers can develop robust strategies to minimize the impact of resistance on the clinical utility of Lgt inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.