Recombinant Erwinia carotovora subsp. atroseptica Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

glpG is a recombinant protein derived from Pectobacterium atrosepticum (formerly Erwinia carotovora subsp. atroseptica). Key attributes include:

  • UniProt Accession: Q6D9D3 (conflicting with Q6CZL3 in , likely due to isoform variations).

  • Sequence: 276 amino acids (see for full sequence).

  • Topology: Six transmembrane domains (TMDs) , though some homologs (e.g., Shigella sonnei Rhom7) exhibit seven TMDs .

  • Catalytic Dyad: Ser201 and His254 .

  • Purity: >85% (SDS-PAGE) .

PropertyDetailSource
Molecular Weight~38 kDa (estimated from sequence length)
Storage ConditionsLyophilized: 12 months at -20°C/-80°C; Liquid: 6 months at -20°C/-80°C
Tag InformationTris-based buffer with 50% glycerol (exact tag type not specified)

Catalytic Mechanism

glpG cleaves transmembrane domains (TMDs) of substrate proteins via a rate-driven process:

  1. Substrate Engagement: TMDs interact with the enzyme’s hydrophobic groove .

  2. Unwinding: Proline residues in substrates facilitate helix destabilization .

  3. Cleavage: Ser201 attacks the carbonyl carbon of the scissile bond, forming a tetrahedral intermediate stabilized by His254 .

Key Inhibitors:

InhibitorMechanismSource
Diisopropyl fluorophosphonate (DFP)Covalently binds Ser201, mimicking the transition state
7-Amino-4-chloro-3-methoxyisocoumarinForms acyl-enzyme intermediate with Ser201 and His254

Biological Roles and Substrate Specificity

glpG primarily targets orphan proteins to prevent aggregation and maintain proteostasis.

Quality Control of Respiratory Complexes

In Shigella sonnei and E. coli, glpG cleaves orphan subunits of:

  • Hydrogenase-2 (Hyd-2): HybA and HybO .

  • Formate Dehydrogenases: FdoH (O complex) and FdnH (N complex) .

  • Type 1 Pili: Required for biofilm formation and host cell colonization .

Regulation:

  • Cleavage occurs only when substrates are orphaned (e.g., HybA in the absence of HybB) .

  • Partner proteins (e.g., HybB) protect substrates from glpG-mediated degradation .

Virulence and Pathogen Persistence

In E. coli, glpG deficiency reduces:

  • Biofilm Formation: Linked to impaired FimA (type 1 pilin) processing .

  • Colonization: Affects adhesion to uroepithelial cells .

Experimental Tools

  • ELISA Kits: Available for detecting glpG in recombinant systems (50 µg per kit) .

  • Mutagenesis Studies: Active-site mutants (e.g., S201A, S133A) validate substrate specificity .

Therapeutic Potential

  • Antimicrobial Targets: Inhibiting glpG could disrupt biofilm formation and virulence factor production .

  • Mechanistic Models: Insights into rhomboid-mediated intramembrane proteolysis inform drug design for eukaryotic systems .

Comparative Analysis with Homologs

FeatureE. carotovora glpGE. coli glpGShigella Rhom7
TMDs667
Key SubstratesHyd-2, FdnHHyd-2, FdoHFdnH, HybA
Catalytic DyadSer201-His254Ser201-His254Ser133-His187
FunctionOrphan protein degradationMembrane protein quality controlRespiratory complex regulation

Open Questions and Future Directions

  • Substrate Prediction: Systematic identification of glpG targets in Erwinia remains incomplete.

  • Evolutionary Conservation: How rhomboid-mediated quality control mechanisms differ across bacterial lineages.

  • Therapeutic Inhibition: Development of species-specific glpG inhibitors for agricultural or clinical use.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; ECA4138; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
glpG
Target Protein Sequence
MIRVIALSNPRLAQAFVDYMRTQQVHLDMRPQGHEAELWLEDETQLSKVQEALEIFLRDP TNPRYLAASWQTGSMDTGIQYQRYSYLQTLKQKAGPLTLSVMVVTIAVFILMQISGYESV MTWLAFPAEGQQLQLWRWFSHALLHFSLLHILFNLMWWWYLGGPVEKVLGTGKLLVIALV SALVSGWAQSWCSGTYFGGLSGVVYALMGYVWLRGEREPDGYLSMPRSLMAFALLWLVAG YFDILGMSIANAAHVAGLIVGLLMAFWDTYNKTNPR
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: eca:ECA4138

STRING: 218491.ECA4138

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of glpG in Erwinia carotovora?

The rhomboid protease GlpG plays a significant role in bacterial persistence and fitness. Research has demonstrated that GlpG promotes bacterial survival within host environments, particularly in the context of intestinal colonization. Disruption of the glpG gene significantly impairs bacterial survival in mouse gut colonization models where the natural microbiota is unperturbed, revealing a novel biological function for this rhomboid protease . This represents an unusual instance where a rhomboid protease substantially impacts bacterial fitness, opening numerous questions about GlpG's precise functions and mechanisms of action.

What methodologies are commonly used to study rhomboid proteases like glpG?

Studying rhomboid proteases typically involves multiple complementary approaches:

  • Genetic manipulation techniques: Targeted gene disruption, complementation studies, and transposon mutagenesis (Tn-seq) to identify fitness determinants under specific growth conditions.

  • Growth phenotype characterization: Comparative growth analysis in defined media with various carbon sources (e.g., glucose vs. mucus substrates) under conditions mimicking the natural environment (such as microaerobic conditions for gut environment studies) .

  • In vivo colonization models: Mouse intestinal colonization assays with wild-type and mutant strains to assess survival capabilities in complex biological environments.

  • Protein expression and purification: Recombinant expression systems, often utilizing E. coli hosts with optimized fed-batch cultivation strategies to achieve high yields of active enzyme .

How can production of recombinant glpG be optimized in heterologous expression systems?

Optimizing recombinant glpG production requires systematic evaluation of cultivation strategies, particularly in fed-batch bioreactor settings. While specific parameters for glpG have not been directly reported in the provided references, similar enzyme production approaches can be adapted. For example, recombinant enzyme production in E. coli using different feeding strategies shows that DO-stat (dissolved oxygen) feeding with induction at 18 hours of culture can yield maximum enzyme activities .

The optimization process should include the following considerations:

ParameterOptimization RangeMonitoring Metrics
Feeding strategyPulse, DO-stat, pH-statEnzyme activity (U/L)
Induction timingEarly (6-12h), Mid (12-24h), Late (>24h)Yield per substrate (U/g)
Temperature25-37°CYield per biomass (U/g cells)
Inducer concentration0.1-1.0 mM IPTG (for lac-based systems)Productivity (U/L·h)
Medium compositionCarbon:nitrogen ratio variationsSpecific activity (U/mg)

When implementing a DO-stat feeding strategy with appropriate induction timing, researchers can expect to achieve significantly higher enzyme yields compared to batch cultivation methods. The optimization should be guided by multivariate design of experiments (DOE) to efficiently identify optimal conditions with minimal experimental runs .

What molecular mechanisms underlie glpG's influence on bacterial persistence in host environments?

The molecular mechanisms through which glpG promotes bacterial persistence involve complex interactions with host substrates and bacterial metabolic pathways. While direct mechanistic data for glpG in Erwinia carotovora is limited, related research suggests several potential mechanisms:

  • Metabolic adaptation: GlpG likely influences the bacterium's ability to utilize specific carbon sources present in host environments. Studies have shown that glpG mutation impairs growth on oleate as a sole carbon source, suggesting involvement in fatty acid metabolism pathways .

  • Proteolytic regulation: As a rhomboid protease, GlpG likely cleaves specific protein substrates that modulate bacterial adaptation to host environments. Identifying these substrates is crucial for understanding the complete mechanism.

  • Membrane protein processing: Rhomboid proteases typically function in membrane protein processing, potentially affecting signaling pathways, transport systems, or virulence factor expression.

  • Stress response modulation: GlpG may influence bacterial persistence by modulating responses to environmental stresses encountered within the host, such as oxidative stress, antimicrobial peptides, or pH fluctuations.

Future research should focus on identifying specific GlpG substrates through proteomics approaches and characterizing the biochemical consequences of substrate cleavage on bacterial fitness determinants.

How does the function of glpG in Erwinia carotovora compare to homologous rhomboid proteases in other bacterial species?

Comparative genomic and functional analyses across different bacterial species would likely reveal evolutionary patterns in rhomboid protease function. This is particularly interesting in the context of Erwinia carotovora, where the carbapenem gene cluster (car genes) shows sophisticated genetic organization with operons controlled by LuxR-type transcriptional activators . The potential interaction between glpG and these systems remains an open question for exploration.

What approaches should be used to determine glpG substrate specificity?

Determining the substrate specificity of glpG requires a multi-faceted approach combining in vitro biochemical assays with in vivo validation strategies:

  • Recombinant protein expression and purification: Express and purify recombinant glpG with appropriate tags for detection and purification, while ensuring preservation of enzymatic activity.

  • In vitro proteolysis assays: Test candidate substrates using purified glpG and analyze cleavage products by techniques such as SDS-PAGE, Western blotting, or mass spectrometry.

  • Proteome-wide substrate identification: Implement comparative proteomics between wild-type and glpG-deficient strains to identify proteins with altered abundance or processing patterns.

  • Substrate validation: Confirm direct substrate cleavage using site-directed mutagenesis of potential cleavage sites and assess the functional consequences of preventing substrate processing.

  • Structural analysis: Where possible, determine the three-dimensional structure of glpG through X-ray crystallography or cryo-EM to identify substrate-binding domains and catalytic residues.

  • Bioinformatic prediction: Utilize sequence analysis and structural modeling to predict potential substrates based on homology to known rhomboid protease recognition motifs.

The integration of these approaches will provide a comprehensive understanding of glpG substrate specificity and how it relates to biological function.

How can multivariate design of experiments (DOE) be applied to optimize glpG activity assays?

Multivariate DOE offers a systematic approach to optimize experimental conditions for glpG activity assays while minimizing the number of experiments required. The following methodology is recommended:

Step 1: Screening Phase
Implement a two-factor level design (such as Plackett-Burman or fractional factorial design) to identify significant variables affecting glpG activity from among:

  • pH (range 6.0-8.5)

  • Temperature (25-45°C)

  • Buffer composition

  • Ionic strength

  • Substrate concentration

  • Enzyme concentration

  • Presence of potential cofactors

  • Incubation time

Step 2: Optimization Phase
Based on significant factors identified in the screening phase, implement a response surface methodology using:

  • Central composite design

  • Box-Behnken design

  • Doehlert design

These designs allow for the exploration of optimal conditions with three or more factor levels .

Step 3: Model Construction and Validation
Construct a mathematical model using a second-order polynomial function or artificial neural network methodology to predict optimal conditions. The model should be validated with confirmation experiments at predicted optimal conditions.

This systematic approach significantly reduces experimental effort while providing robust optimization of assay conditions, especially important for enzymes like glpG that may have complex activity profiles dependent on multiple variables.

What analytical methods are most effective for quantifying glpG expression and activity in bacterial samples?

Effective quantification of glpG expression and activity requires complementary analytical approaches:

For Expression Quantification:

  • qRT-PCR: Quantitative reverse transcription PCR enables precise measurement of glpG mRNA expression levels relative to reference genes.

  • Western Blotting: Using specific antibodies against glpG allows protein-level quantification, though this requires generation of high-quality antibodies.

  • Mass Spectrometry: Targeted proteomics approaches like selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can provide absolute quantification of glpG protein.

For Activity Quantification:

  • Fluorogenic Substrate Assays: Development of specific fluorogenic peptide substrates that increase fluorescence upon cleavage by glpG.

  • LC-MS/MS-Based Activity Assays: Monitor the appearance of cleavage products from defined substrates using liquid chromatography coupled with tandem mass spectrometry.

  • In-Gel Activity Assays: Zymography techniques adapted for proteases can visualize active enzyme directly in polyacrylamide gels.

When implementing these methods, consider adapting approaches from established protocols for other biomolecules where LC/MS has been effectively used for quantification . The integration of biological metrics (such as comparing wild-type versus knockout strains) with detailed spectral analysis provides particularly robust analytical outcomes.

How can contradictory findings between in vitro and in vivo glpG studies be reconciled?

Reconciling contradictory findings between in vitro and in vivo studies of glpG requires careful analysis of experimental conditions and biological context:

  • Environmental complexity analysis: The research indicates that while both glpG and glpR mutations impair growth in mucus in vitro, only glpG disruption significantly reduces survival in the intact mouse intestinal environment . This suggests that glpG's role extends beyond the simple metabolic functions that can be modeled in vitro.

  • Systematic variable isolation: To reconcile contradictory findings, researchers should design experiments that systematically introduce components of the in vivo environment into in vitro systems. For example:

    • Testing growth in the presence of specific microbiota species

    • Incorporating host-derived immune factors

    • Simulating spatial structure and biofilm formation

    • Replicating fluctuating nutrient availability

  • Temporal considerations: In vivo persistence often involves temporal adaptation processes that may not be captured in short-term in vitro assays. Extended time-course experiments can help bridge this gap.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from both conditions can identify differentially regulated pathways that explain the discrepancies.

By implementing these strategies, researchers can develop more sophisticated models that better predict in vivo behavior and explain apparently contradictory results.

What are the implications of glpG research for understanding bacterial adaptation to host environments?

Research on glpG has significant implications for understanding bacterial adaptation to host environments:

  • Novel persistence mechanisms: The finding that glpG promotes bacterial persistence in the intestinal tract highlights a previously unrecognized mechanism by which bacteria adapt to host environments . This expands our understanding beyond traditional virulence factors to include metabolic adaptation proteins.

  • Metabolic niche exploitation: The involvement of glpG in growth on specific carbon sources like oleate suggests that rhomboid proteases may regulate how bacteria exploit specific metabolic niches within the host, particularly in lipid-rich environments.

  • Microbiome interactions: The differential requirement for glpG in the presence of intact microbiota versus in vitro conditions suggests that this protease may mediate interactions with other microorganisms or influence competitive fitness in complex communities.

  • Evolutionary specialization: The specific role of glpG that isn't compensated by glpR in vivo suggests evolutionary specialization of this rhomboid protease for host adaptation, potentially representing a convergent evolutionary strategy across multiple bacterial species.

  • Therapeutic targeting potential: Understanding the precise mechanism of glpG's contribution to bacterial persistence could reveal new strategies for disrupting bacterial colonization without broadly disrupting the microbiome.

These implications highlight the importance of continued research on bacterial rhomboid proteases as mediators of host-microbe interactions.

What emerging technologies could advance our understanding of glpG function and regulation?

Several emerging technologies show particular promise for advancing glpG research:

  • CRISPR-Cas9 genome editing: Precise genetic manipulation to create targeted mutations, domain swaps, or reporter fusions without polar effects on downstream genes.

  • Single-cell analysis techniques: Technologies like single-cell RNA-seq and time-lapse microscopy to examine cell-to-cell variation in glpG expression and its impact on bacterial fitness.

  • In situ proteomics: Methods like proximity labeling to identify proteins that interact with glpG in their native cellular context.

  • Microfluidic devices: Systems that simulate the dynamic conditions of the host environment while allowing real-time observation of bacterial responses.

  • Advanced structural biology: Techniques like cryo-electron microscopy and AlphaFold2 predictions to determine the structure of glpG and its complexes with substrates or regulatory partners.

  • Metabolic flux analysis: Stable isotope labeling combined with metabolomics to track how glpG influences carbon flow through different metabolic pathways.

  • Host-microbe co-culture systems: Organoid technology combined with bacterial culture to model complex tissue-level interactions in a controlled setting.

These technologies, especially when applied in combination, have the potential to resolve current knowledge gaps and provide a systems-level understanding of glpG function.

How might knowledge about glpG contribute to developing novel antimicrobial strategies?

Understanding glpG function could inform novel antimicrobial strategies in several ways:

  • Anti-virulence approach: If glpG is essential for bacterial persistence but not for growth in laboratory conditions, inhibitors could potentially reduce colonization without creating strong selection pressure for resistance.

  • Metabolic vulnerability targeting: The connection between glpG and specific carbon source utilization suggests that understanding this pathway could reveal metabolic vulnerabilities that could be therapeutically exploited.

  • Combination therapy enhancement: Inhibitors of glpG could potentially sensitize bacteria to existing antibiotics by preventing adaptive responses that contribute to persistence.

  • Microbiome-sparing treatments: The apparent specificity of glpG function suggests that targeting this protease might affect pathogenic bacteria while sparing beneficial members of the microbiome.

  • Biofilm disruption: If glpG plays roles in biofilm formation or maintenance, inhibitors could help disperse bacterial communities that are otherwise resistant to antibiotic treatment.

It's worth noting that Erwinia species produce their own beta-lactam antibiotic (1-carbapen-2-em-3-carboxylic acid) and have evolved self-resistance mechanisms . Studying how glpG might interact with these systems could provide insights into novel antimicrobial resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.