Recombinant Erwinia carotovora subsp. atroseptica sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

UgpA operates as part of the UgpABCEQ transporter, which is induced under phosphate starvation . Key functional insights include:

  • Substrate Specificity: Transports sn-glycerol-3-phosphate, a phospholipid precursor and phosphate source .

  • Regulation: Expression is controlled by the Pho regulon, activated during phosphate limitation .

  • Pathogenicity: In E. carotovora subsp. atroseptica, UgpA contributes to virulence by supporting nutrient acquisition in plant hosts. Proteomic analyses revealed that DsbA (a disulfide bond-forming enzyme) is essential for UgpA stability and secretion, linking its function to extracellular virulence factor production .

Secretome Analysis in E. carotovora subsp. atroseptica

Proteomic studies comparing wild-type and dsbA mutants demonstrated that UgpA secretion is DsbA-dependent. Key observations include:

  • DsbA Dependency: Inactivation of dsbA reduced UgpA levels in the secretome by >90%, impairing motility and extracellular enzyme activity .

  • Virulence Impact: dsbA mutants showed attenuated virulence due to disrupted secretion of UgpA and other Out system-dependent proteins .

Transport Mechanism

Functional assays revealed:

  • Binding Protein Requirement: UgpA-mediated transport requires the periplasmic binding protein UgpB for substrate recognition .

  • Metabolic Role: Despite efficient G3P transport, UgpA does not support growth on G3P as a sole carbon source but enables phosphate scavenging .

Biotechnological Applications

Recombinant UgpA is commercially available for research, with applications in:

  • Membrane Protein Studies: Used to investigate ABC transporter mechanics .

  • Antimicrobial Targeting: Explored as a candidate for disrupting bacterial phosphate uptake .

Product NameHost SystemPuritySource Organism
Recombinant Full-Length UgpA (Q6CZ32) E. coli≥85%E. carotovora subsp. atroseptica
Recombinant UgpA Partial Sequence (MBS7076994) Multiple systems≥85%E. carotovora subsp. atroseptica

Evolutionary and Comparative Insights

UgpA homologs share >60% sequence similarity across bacterial genera. Notable examples:

OrganismGene IDFunction
Mycobacterium tuberculosisRv2835cG3P transport; non-essential for growth
Escherichia colib3452 (ugpA)Pho regulon-regulated permease
Yersinia pestisugpAVirulence-associated transporter

Future Directions

Research priorities include resolving UgpA’s crystal structure and engineering inhibitors to block phosphate uptake in plant pathogens. Its role in microbial ecology, particularly in marine environments where Ugp transporters are widespread , also warrants exploration.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your desired format in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery timelines may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize fulfilling your request.
Synonyms
ugpA; ECA4321; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
ugpA
Target Protein Sequence
MTSSRPVFRSSWLPYVLVLPQLLITVIFFIWPAGQALWYSVQNLDPFGLSSEFVGMENFR QLFNNPYYLDSFYTTLIFSFLVAGFGMLISLFLAALVDYVIRASRLYQTLIILPYAVAPA VAAVLWMFLFNPGLGLITHFLGLLGYTWNHAQDSGQAMFLVVLASVWKQISYNFLFFLAA LQSIPRSLVEAGAIDGAGPVRRFFNLVLPMISPVSFFLLVVNLVYAFFDTFPIIDAATAG GPVQSTTTLIYKIYREGFAGLDLSSSAAQSVILMLLVIGLTVIQFRFVERKVNYQ
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: eca:ECA4321

STRING: 218491.ECA4321

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ugpA and what is its function in Erwinia carotovora?

The ugpA (Uniprot NO.: Q6CZ32) is a permease protein component of the sn-glycerol-3-phosphate transport system in Erwinia carotovora subsp. atroseptica (also known as Pectobacterium atrosepticum). It functions as an integral membrane protein within the binding protein-dependent transport system for sn-glycerol-3-phosphate (G3P). The ugpA protein forms part of a transmembrane complex that facilitates the movement of G3P across the bacterial cell membrane, playing a crucial role in phospholipid biosynthesis and phosphate metabolism .

To investigate ugpA function, researchers should consider:

  • Membrane protein isolation techniques that preserve native conformation

  • Transport assays using radiolabeled G3P substrates

  • Genetic complementation studies in ugpA-deficient strains

  • Protein-protein interaction studies to identify binding partners within the transport complex

How is the ugp transport system regulated in bacteria?

The ugp-dependent transport system for sn-glycerol-3-phosphate is primarily regulated by phosphate availability. The system is induced under conditions of phosphate starvation and in mutants that are constitutive for the pho regulon . This regulatory pattern suggests an important role for the ugp system in bacterial adaptation to phosphate-limited environments.

Methodological approaches to study ugp regulation include:

  • Growth under controlled phosphate concentrations to monitor ugp expression

  • Reporter gene fusions to measure promoter activity under various conditions

  • Deletion analysis of upstream regulatory regions

  • Transcription factor binding assays to identify regulatory proteins

  • Chromatin immunoprecipitation to confirm in vivo binding of regulators

What are the structural characteristics of ugpA protein?

The ugpA protein from Erwinia carotovora subsp. atroseptica is a membrane protein consisting of 295 amino acids. The protein contains multiple transmembrane domains that anchor it within the bacterial membrane . The hydrophobic nature of these domains facilitates the formation of a channel through which the sn-glycerol-3-phosphate substrate can pass.

When studying ugpA structure, researchers should employ:

  • Hydropathy plot analysis to identify transmembrane segments

  • Protein topology prediction algorithms to determine membrane orientation

  • Site-directed mutagenesis of conserved residues to identify functional domains

  • Structural modeling based on homologous proteins with resolved crystal structures

  • Circular dichroism spectroscopy to assess secondary structure content

What are the storage requirements for recombinant ugpA protein?

Recombinant ugpA protein requires specific storage conditions to maintain stability and functionality:

Storage ParameterRecommendationNotes
Buffer compositionTris-based buffer with 50% glycerolOptimized for this specific protein
Short-term storage4°CFor up to one week
Medium-term storage-20°CStandard freezer conditions
Long-term storage-80°CFor extended preservation
Handling considerationsAvoid repeated freeze-thaw cyclesMaintains protein integrity

These storage conditions help preserve the structural integrity and functional activity of the recombinant protein for experimental use .

How does the ugpA protein compare between Erwinia carotovora and other bacterial species?

The ugp transport system for sn-glycerol-3-phosphate is present in various bacterial species, with notable similarities and differences in structure and function:

SpeciesFunctional CharacteristicsRegulatory MechanismsKey Differences
E. carotovoraBinding protein-dependentInduced by phosphate starvationPart of ECA4321 locus
E. coliBinding protein-dependentRegulated by pho regulonKm value of ~14 μM for G3P
S. typhimuriumBinding protein-dependentDerepressed by phosphate starvationKm value of ~50 μM for G3P

When comparing ugpA across species, researchers should employ sequence alignment tools, phylogenetic analysis, and functional complementation studies to investigate evolutionary conservation and species-specific adaptations .

What methodological approaches should be used for expressing and purifying recombinant ugpA?

Expression and purification of membrane proteins like ugpA require specialized techniques:

  • Expression system selection:

    • E. coli BL21(DE3) strain has proven effective for expressing recombinant proteins from Erwinia species

    • Consider using specialized vectors designed for membrane protein expression

    • Optimize codon usage for the host expression system

  • Induction and culture conditions:

    • Test multiple induction timepoints to maximize protein yield

    • Consider DO-stat feeding strategies for high-density cultures

    • Optimize temperature and inducer concentration

  • Extraction and purification:

    • Use mild detergents for membrane protein solubilization

    • Employ affinity chromatography with appropriate tags

    • Consider native purification methods to maintain protein activity

  • Quality assessment:

    • Verify protein integrity through SDS-PAGE and Western blotting

    • Confirm protein activity through functional assays

    • Assess protein homogeneity through size exclusion chromatography

How can researchers assess the impact of mutations in ugpA on transport efficiency?

To evaluate how specific mutations affect ugpA function, researchers should implement a systematic approach:

  • Site-directed mutagenesis targeting:

    • Conserved residues identified through multiple sequence alignments

    • Predicted transmembrane domains

    • Potential substrate binding sites

    • Protein-protein interaction interfaces

  • Functional characterization through:

    • Transport assays using radiolabeled sn-glycerol-3-phosphate

    • Growth complementation studies in ugpA-deficient strains

    • In vitro reconstitution in proteoliposomes

    • Protein-protein interaction analysis with other transport components

  • Data analysis framework:

    • Determine kinetic parameters (Km, Vmax) for each mutant

    • Compare transport efficiency relative to wild-type protein

    • Assess protein stability and membrane localization

    • Correlate structural changes with functional outcomes

What is the role of ugpA in bacterial adaptation to phosphate-limited environments?

The ugp transport system plays a crucial role in bacterial survival under phosphate limitation:

  • Functional significance:

    • Provides an alternative phosphate source through sn-glycerol-3-phosphate uptake

    • Contributes to phospholipid biosynthesis under limiting conditions

    • Integrates with other phosphate scavenging mechanisms

  • Experimental approaches to study adaptive responses:

    • Transcriptional profiling under phosphate limitation

    • Competitive growth assays between wild-type and ugpA mutants

    • Metabolic flux analysis to track phosphate utilization

    • In vivo expression studies using reporter fusions

  • Assessment of ugpA contribution to fitness:

    • Survival rates under extended phosphate starvation

    • Biofilm formation capabilities

    • Competitive index in mixed populations

    • Phosphate uptake efficiency measurements

How can researchers design experiments to study interactions between ugpA and other components of the transport system?

The ugp transport system involves multiple proteins functioning as a complex. To study these interactions:

  • Protein-protein interaction mapping:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation with tagged proteins

    • Cross-linking followed by mass spectrometry

    • Surface plasmon resonance for binding kinetics

  • Structural analysis of protein complexes:

    • Cryo-electron microscopy of reconstituted complexes

    • X-ray crystallography of co-purified components

    • Homology modeling based on related transport systems

    • Molecular dynamics simulations

  • Functional reconstitution studies:

    • Proteoliposome reconstitution with purified components

    • Transport activity measurements with systematic protein omissions

    • Complementation assays with chimeric proteins

    • FRET-based approaches to monitor dynamic interactions

What approaches can be used to study the regulation of ugpA expression in different environmental conditions?

To understand how environmental factors influence ugpA expression:

TechniqueApplicationData ObtainedLimitations
qRT-PCRTranscript quantificationRelative expression levelsPost-transcriptional regulation not captured
Western blottingProtein level analysisProtein abundanceRequires specific antibodies
Reporter fusionsPromoter activityTranscriptional regulationMay not reflect native context
ChIP-seqRegulator bindingTranscription factor interaction sitesLabor intensive
RNA-seqGlobal expression patternsTranscriptome-wide changesRequires bioinformatic expertise

When designing such experiments, researchers should include appropriate controls and time-course analyses to capture dynamic regulatory responses .

How should researchers develop an experimental pipeline for studying recombinant ugpA?

A comprehensive research pipeline for investigating ugpA should include:

  • Preparation phase:

    • Gene cloning and construct design

    • Expression system optimization

    • Purification strategy development

    • Validation of protein quality

  • Structural characterization:

    • Secondary structure determination

    • Membrane topology mapping

    • Oligomerization state assessment

    • Identification of functional domains

  • Functional analysis:

    • Transport activity assays

    • Substrate specificity determination

    • Kinetic parameter measurement

    • Inhibitor screening

  • Interaction studies:

    • Identification of binding partners

    • Characterization of protein complexes

    • Assessment of regulatory interactions

    • In vivo localization studies

What data management and analysis strategies are recommended for ugpA research?

When conducting ugpA research, data management is critical for maintaining research trustworthiness:

This structured approach to data management enhances research reproducibility and facilitates transparent reporting of methods and results .

What are the emerging areas of research involving ugpA and related transport systems?

Future research on ugpA and the sn-glycerol-3-phosphate transport system may focus on:

  • Structure-function relationships:

    • High-resolution structural studies of the complete transport complex

    • Mechanistic insights into substrate translocation

    • Dynamic changes during transport cycles

  • Systems biology approaches:

    • Integration of ugp system with global phosphate regulatory networks

    • Metabolic modeling of phosphate utilization pathways

    • Multi-omics analysis of adaptation to phosphate limitation

  • Biotechnological applications:

    • Engineering improved transport efficiency for bioremediation

    • Development of biosensors for phosphate monitoring

    • Therapeutic targeting of bacterial phosphate acquisition systems

  • Comparative genomics:

    • Evolution of ugp systems across bacterial species

    • Identification of species-specific adaptations

    • Correlation of transport system variations with ecological niches

How can contradictory findings in ugpA research be reconciled through experimental design?

When faced with conflicting results in ugpA research, consider these methodological approaches:

  • Standardization of experimental conditions:

    • Define precise growth conditions to control for regulatory variables

    • Standardize protein preparation protocols

    • Establish consistent assay conditions for functional measurements

  • Systematic comparison of methodologies:

    • Side-by-side testing of different expression systems

    • Parallel application of multiple analytical techniques

    • Cross-validation with independent methodological approaches

  • Exploration of biological variables:

    • Test strain-specific differences in ugpA function

    • Investigate environmental factors affecting transport activity

    • Examine post-translational modifications or regulatory mechanisms

  • Collaborative verification:

    • Engage multiple laboratories in replication studies

    • Share materials and detailed protocols

    • Establish consensus methodologies through research networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.