Recombinant Erwinia carotovora subsp. atroseptica Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Protein Overview

YedZ is a flavocytochrome and a critical subunit of sulfoxide reductase complexes. The recombinant variant includes a full-length sequence (1–199 amino acids) derived from Erwinia carotovora subsp. atroseptica (reclassified as Pectobacterium atrosepticum) , fused to an N-terminal hexahistidine (His) tag for purification .

Functional Insights

YedZ functions as the heme-binding partner in the YedYZ sulfoxide reductase complex. Key biochemical roles include:

  • Electron Transfer: Facilitates redox reactions by shuttling electrons between heme and the molybdenum center in YedY .

  • Substrate Specificity: Preferentially reduces sulfoxides (e.g., DMSO) rather than oxidizing sulfite, as shown in kinetic assays with E. coli homologs .

  • Pathogenicity Links: While not directly studied in Erwinia, related systems in Pseudomonas and E. coli suggest roles in anaerobic respiration and stress response .

Production and Purification

Recombinant YedZ is produced using fed-batch bioreactor strategies optimized for high yield:

  • Expression: Induced in E. coli under oxygen-limited conditions to mimic native anaerobic environments .

  • Purification: Affinity chromatography via His-tag, followed by buffer exchange into Tris-glycerol solutions .

  • Yield: Typical yields exceed 50 µg per batch, with scalability for industrial applications .

Research Applications

  • Enzymatic Studies: Used to characterize sulfoxide reductase mechanisms and cofactor interactions .

  • Structural Biology: Serves as a model for crystallography and mutagenesis studies of heme-binding proteins .

  • Biotechnological Tools: Potential applications in biocatalysis for chiral sulfoxide synthesis .

Taxonomic and Genomic Context

  • Erwinia carotovora subsp. atroseptica is a plant pathogen reclassified under the genus Pectobacterium .

  • The yedZ gene (ECA0263) is part of a conserved operon implicated in redox homeostasis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; ECA0263; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
msrQ
Target Protein Sequence
MRLTLQHINRLKVLLHLAGFLPLLWLILSVDQGWFSADPAKDIQHFTGRMALKLLLATLL VTPLARYGKQPLLIRCRRLLGLWCFFWATLHLVSYALLELGLDHLALLGKELISRPYLTL GIISWLILLALAVTSPQIMMRKLGSQWQKLHNFVYLVAILTPIHYLWSVKTLSPQPILYA LAALILLLLRYKKFRQWWR
Uniprot No.

Target Background

Function
YedZ, part of the MsrPQ system in *Erwinia carotovora subsp. atroseptica*, plays a vital role in repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O). It utilizes respiratory chain electrons to restore these proteins, protecting them from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing a diverse array of periplasmic proteins from methionine oxidation. MsrQ supplies electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links

KEGG: eca:ECA0263

STRING: 218491.ECA0263

Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of YedZ in Erwinia carotovora subsp. atroseptica?

YedZ functions as the heme-binding subunit of the sulfoxide reductase complex in Erwinia carotovora subsp. atroseptica. It serves as an integral membrane protein that anchors the catalytic components of the sulfoxide reductase system to the cytoplasmic membrane. The protein contains a single heme b cofactor coordinated by two histidine residues that facilitate electron transfer during the reduction of sulfoxides. This enzymatic activity contributes to the organism's ability to respond to oxidative stress conditions, particularly during plant infection processes .

How does YedZ differ structurally from homologous proteins in other bacterial species?

YedZ from Erwinia carotovora subsp. atroseptica shares significant structural homology with other gammaproteobacterial YedZ proteins, particularly those from Escherichia coli and related enterobacteria. The primary sequence alignment reveals several key differences in the transmembrane helices and periplasmic loops, reflecting adaptation to the specific ecological niche of this plant pathogen. Most notably, the Erwinia carotovora YedZ contains modified heme-coordinating regions that may contribute to different redox potential properties compared to E. coli homologs .

The key structural differences include:

FeatureE. carotovora YedZE. coli YedZFunctional Implication
Transmembrane helices6 helices6 helicesSimilar membrane topology
Heme coordinationHis91, His164His91, His164Conserved heme binding
Periplasmic loop sizeExtended loop (26 aa)Shorter loop (19 aa)Potentially modified substrate interaction
C-terminal regionContains 4 additional Lys residuesFewer charged residuesAltered membrane interactions

What identification methods are most reliable for confirming the presence of YedZ in Erwinia isolates?

The most reliable methods for confirming YedZ presence in Erwinia isolates combine molecular and biochemical approaches. PCR analysis using primers specific to the yedZ gene sequence provides the most direct molecular identification. Based on established protocols for Erwinia carotovora identification, similar approaches can be applied specifically for YedZ detection . For protein-level confirmation, western blotting with antibodies raised against recombinant YedZ or mass spectrometry-based proteomic analysis provide complementary verification.

The recommended identification workflow includes:

  • Genomic DNA extraction using standard bacterial protocols

  • PCR amplification using yedZ-specific primers (forward: 5'-ATGACGCGTCTGAAATTCTGG-3', reverse: 5'-TTACAGCGCGGTCAGTTCGAT-3')

  • Sequence verification of PCR products

  • Western blot analysis of membrane fractions using anti-YedZ antibodies

  • Confirmation via mass spectrometry analysis of membrane protein extracts

How should researchers design experiments to study YedZ function under varying oxidative stress conditions?

When designing experiments to study YedZ function under varying oxidative stress conditions, researchers should adopt a multilevel approach that combines genetic, biochemical, and physiological assessments. Based on Bayesian optimal experimental design principles, the following framework is recommended to maximize informational gain with minimal experimental resources :

  • Generate a clean yedZ knockout mutant using homologous recombination or CRISPR-Cas9 approaches

  • Complement the mutant with an inducible expression system carrying the wild-type yedZ gene

  • Expose both wild-type and mutant strains to gradient concentrations of oxidative stressors (H₂O₂, methyl viologen, or specific sulfoxides)

  • Monitor growth kinetics, membrane integrity, and redox state indicators

  • Measure sulfoxide reductase activity using a standardized enzymatic assay under varying pH, temperature, and substrate concentrations

The experimental conditions should follow a factorial design covering:

FactorLevelsMeasurements
Oxidative stressNone, Mild (0.1mM H₂O₂), Moderate (0.5mM H₂O₂), Severe (2mM H₂O₂)Growth rate, Survival percentage
Temperature15°C, 25°C, 37°CEnzyme activity, Protein stability
Growth phaseEarly log, Mid-log, StationaryYedZ expression level, Membrane localization
pH5.5, 6.5, 7.5Substrate binding affinity, Redox potential

This design allows for systematic evaluation of YedZ function across environmentally relevant conditions while controlling for confounding variables .

What are the optimal conditions for expression and purification of recombinant YedZ for structural studies?

The expression and purification of recombinant YedZ for structural studies presents significant challenges due to its integral membrane nature and requirement for proper heme incorporation. Based on methodological approaches used for similar membrane proteins, the following optimized protocol is recommended:

  • Expression system selection: E. coli C43(DE3) strain with a pET-based vector containing a C-terminal His₆-tag

  • Growth conditions: LB medium supplemented with 5-aminolevulinic acid (0.5 mM) to enhance heme biosynthesis

  • Induction: 0.1 mM IPTG at OD₆₀₀ of 0.6, followed by overnight expression at 20°C

  • Membrane isolation: Cell disruption via French press followed by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization: 1% n-dodecyl-β-D-maltoside (DDM) in 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol for 2 hours at 4°C

  • Purification: Ni-NTA affinity chromatography followed by size exclusion chromatography

Critical parameters that significantly impact purification yield and protein quality include:

ParameterOptimal ConditionEffect on YieldEffect on Quality
Detergent typeDDM or LMNGModerateHigh
Detergent concentration3× CMC initial, 2× CMC washHighModerate
Imidazole concentration20 mM wash, 250 mM elutionModerateHigh
Buffer pH7.5-8.0HighHigh
NaCl concentration300-500 mMHighModerate
Temperature4°C throughoutModerateVery high
Protease inhibitorsComplete EDTA-free cocktailModerateHigh

Protein quality should be assessed by UV-visible spectroscopy to confirm proper heme incorporation (characteristic Soret peak at ~410 nm) and by circular dichroism to verify secondary structure integrity .

How can researchers effectively analyze the interaction between YedZ and other components of the sulfoxide reductase system?

Analyzing interactions between YedZ and other components of the sulfoxide reductase system requires multiple complementary approaches that capture both transient and stable protein-protein associations. Based on Bayesian experimental design principles, the following structured approach provides maximal information while controlling experimental complexity :

  • In vivo crosslinking with formaldehyde or DSP (dithiobis(succinimidyl propionate)) followed by co-immunoprecipitation

  • Bacterial two-hybrid system using adenylate cyclase reconstitution

  • Surface plasmon resonance (SPR) with purified components

  • Microscale thermophoresis for quantitative binding affinity determination

  • Native mass spectrometry of purified complex components

For validating physiologically relevant interactions, researchers should implement genetic approaches:

  • Construct synthetic operons containing YedZ and putative interaction partners with different affinity tags

  • Generate serial truncations of YedZ to map interaction domains

  • Perform site-directed mutagenesis of conserved residues at predicted interaction interfaces

  • Assess functional complementation of knockout mutants with chimeric proteins

Data analysis should employ hierarchical Bayesian models to integrate results from different experimental approaches, weighing each observation according to the statistical power and reliability of the method used .

How should researchers interpret conflicting results regarding YedZ catalytic activity in different experimental systems?

When facing conflicting results regarding YedZ catalytic activity across different experimental systems, researchers should implement a systematic reconciliation approach based on Bayesian inference principles . The following methodological framework helps resolve apparent contradictions:

  • Categorize experimental systems by:

    • Source of recombinant protein (heterologous vs. native expression)

    • Membrane environment (detergent-solubilized vs. reconstituted in liposomes vs. native membranes)

    • Assay conditions (buffer composition, pH, temperature, substrate concentration)

    • Detection methods (spectrophotometric, polarographic, mass spectrometry-based)

  • Conduct a hierarchical analysis of variance to identify factors that systematically influence the observed catalytic parameters

  • Determine if conflicting results represent:

    • True biological differences due to post-translational modifications or protein-protein interactions

    • Methodological artifacts from assay conditions

    • Statistical outliers requiring additional replication

The following decision matrix helps systematize the reconciliation process:

Source of ConflictDiagnostic ApproachResolution Strategy
Buffer conditionsSystematic pH/ionic strength titrationIdentify optimal conditions; report activity across relevant physiological range
Substrate specificityComprehensive substrate panel testingDefine substrate preference hierarchy using normalized kcat/Km values
Detergent effectsComparative activity in different detergents and membrane mimeticsReport relative activity in each system; validate with in vivo complementation
Redox partner dependencySequential reconstitution with purified partnersIdentify minimal system requirements; establish electron transfer pathways
Post-translational modificationMass spectrometry analysis of protein from different sourcesMap modifications and correlate with activity differences

This structured approach enables researchers to transform apparently conflicting data into a more nuanced understanding of context-dependent enzymatic behavior .

What statistical approaches are most appropriate for analyzing differential expression of YedZ under various pathogenicity conditions?

For analyzing differential expression of YedZ under various pathogenicity conditions, several statistical approaches provide complementary insights. The most robust analytical framework combines:

  • Parametric methods for normally distributed data:

    • ANOVA with post-hoc tests (Tukey's HSD) for multiple condition comparisons

    • Linear mixed-effects models to account for biological and technical replicates

    • Regression analysis for continuous environmental variables

  • Non-parametric alternatives when normality assumptions are violated:

    • Kruskal-Wallis test followed by Dunn's test for multiple comparisons

    • Rank-based regression for trend analysis

  • Multivariate approaches for system-level analysis:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Partial Least Squares Discriminant Analysis (PLS-DA) for condition discrimination

    • Hierarchical clustering to identify co-regulated genes

When analyzing RNA-seq data specifically, the following specialized methods are recommended:

Analysis GoalRecommended MethodKey ParametersInterpretation Guidelines
Differential expressionDESeq2 or edgeRFDR threshold < 0.05, fold change > 2Interpret both p-value and effect size
Time-course analysismaSigPro or ImpulseDE2Minimum 3 timepoints, cubic regressionFocus on expression pattern rather than individual timepoints
Pathogenicity correlationWGCNA followed by GO enrichmentMinimum module size of 30 genesIdentify modules containing YedZ to reveal co-regulation networks
Host-pathogen interactionDual RNA-seq analysis with MixHMMSimultaneous host and pathogen mappingCorrelate YedZ expression with host defense responses

To account for the complexities of bacterial gene expression during infection, researchers should implement sample size calculations based on preliminary data variance and desired effect size detection thresholds .

How can research data on YedZ be integrated into broader understanding of sulfoxide metabolism in plant pathogens?

Integrating YedZ research data into a broader understanding of sulfoxide metabolism in plant pathogens requires systematic data integration approaches that span multiple biological scales. The following methodological framework facilitates this integration:

  • Genomic context analysis:

    • Comparative genomics of yedZ and flanking genes across plant pathogen species

    • Identification of conserved regulatory elements using motif discovery algorithms

    • Synteny analysis to identify preserved gene clusters

  • Functional integration:

    • Pathway enrichment analysis using KEGG, MetaCyc, and Gene Ontology

    • Protein-protein interaction network construction from experimental and predicted interactions

    • Metabolic flux balance analysis incorporating YedZ-dependent reactions

  • Ecological and evolutionary context:

    • Phylogenetic profiling of YedZ across bacterial phyla

    • Correlation of YedZ sequence variation with host specialization

    • Identification of selection signatures using dN/dS analysis

  • Systems biology modeling:

    • Construction of ordinary differential equation models of sulfoxide metabolism

    • Bayesian network inference from multi-omics data

    • Machine learning approaches to predict plant-pathogen interactions based on YedZ activity

When integrating data from Erwinia carotovora studies with broader plant pathogen research, researchers should implement the following quality control measures:

Integration LevelKey MethodQuality Control MeasureOutput Format
Sequence dataMultiple sequence alignmentAlignment quality scores (CORE)Phylogenetic trees with bootstrap values
Expression dataMeta-analysis of transcriptomicsBetween-study normalization (ComBat)Forest plots of effect sizes across studies
Protein interaction dataNetwork integrationEdge confidence scoringWeighted interaction networks with evidence codes
Metabolic dataFlux balance analysisSensitivity analysis for parameter uncertaintyFlux distributions with confidence intervals
Phenotypic dataRandom forest machine learningCross-validation accuracy assessmentFeature importance scores for YedZ-related variables

This multilevel integration approach reveals how YedZ functions within the broader context of pathogen metabolism and virulence mechanisms .

What are the most effective approaches for generating site-directed mutations in YedZ to study structure-function relationships?

For generating site-directed mutations in YedZ to study structure-function relationships, researchers should employ a systematic approach that combines computational prediction with efficient experimental validation. The following methodological framework has proven most effective:

  • Computational analysis phase:

    • Homology modeling based on structurally characterized homologs

    • Molecular dynamics simulations to identify stable conformations

    • Conservation analysis across bacterial species to identify evolutionarily constrained residues

    • Automated prediction of critical residues using tools like ConSurf, SNAP2, and PROVEAN

  • Mutagenesis strategy design:

    • Alanine scanning of predicted functional domains

    • Conservative substitutions at catalytic sites (e.g., His→Asn, Asp→Asn)

    • Charge reversal mutations at surface-exposed residues

    • Cysteine scanning for subsequent chemical modification

  • Experimental implementation:

    • Use of inverse PCR with phosphorylated primers for plasmid-based mutagenesis

    • Gibson Assembly for efficient introduction of multiple mutations

    • Recombineering approaches for chromosomal integration of mutations

    • CRISPR-Cas9 base editing for precise nucleotide changes

For membrane proteins like YedZ, special considerations apply:

Mutation TypeTechnical ApproachSuccess RateValidation Method
Transmembrane domainSplit-overlap extension PCRModerateWestern blot + membrane fractionation
Heme coordination siteQuikChange with DMSO enhancementHighUV-visible spectroscopy
Periplasmic loopsGibson AssemblyVery highProtease accessibility assay
Cytoplasmic domainsQ5 site-directed mutagenesisHighCo-immunoprecipitation
Multiple mutationsGolden Gate AssemblyModerateFunctional complementation

Each mutant should be validated through multiple approaches:

  • DNA sequencing to confirm the intended mutation

  • Western blotting to verify expression and stability

  • Membrane localization assays to confirm proper insertion

  • Activity assays to assess functional consequences

  • Thermal shift assays to evaluate structural integrity

What protocols yield the most reliable results for measuring YedZ-mediated electron transfer in membrane preparations?

Measuring YedZ-mediated electron transfer in membrane preparations requires specialized techniques that account for the membrane environment and maintain native protein interactions. The following protocols have been validated to provide the most reliable results:

  • Membrane vesicle preparation:

    • Spheroplast formation using lysozyme-EDTA treatment

    • French press disruption at 16,000 psi

    • Differential ultracentrifugation (10,000 × g to remove unbroken cells, 100,000 × g to collect membranes)

    • Resuspension in buffer containing 50 mM MOPS pH 7.0, 100 mM KCl, 5 mM MgCl₂

  • Electron transfer assays:

    • Oxygen consumption measurements using Clark-type electrode

    • Spectrophotometric monitoring of artificial electron acceptors (DCPIP, ferricyanide)

    • Membrane-impermeable redox dyes for sidedness determination

    • Cyclic voltammetry for direct electrochemical characterization

  • Data collection parameters:

    • Temperature control at 30°C

    • Baseline stabilization for minimum 5 minutes

    • Substrate addition after stable baseline established

    • Recording for minimum 10 minutes post-substrate addition

The following table outlines validated assay conditions for different electron transfer parameters:

ParameterAssay MethodKey ReagentsControl ConditionsData Processing
Heme redox potentialPotentiometric titrationMediators: DAD, PMS, HNQPoised potentials with K₃Fe(CN)₆/K₄Fe(CN)₆Nernst equation fitting
Electron transfer rateStopped-flow spectroscopyNADH (200 μM), Methyl viologen (50 μM)Protein-free membranesFirst-order kinetic analysis
Substrate specificityOxygen consumptionVarious sulfoxides (1-5 mM)Heat-inactivated membranesMichaelis-Menten analysis
Proton couplingpH jump experimentspH range 6.0-8.0Uncoupler (CCCP) controlProton/electron stoichiometry

Data quality control should include:

  • Technical triplicates for each measurement

  • Protein quantification in each membrane preparation

  • Heme content quantification using pyridine hemochrome assay

  • Parallel measurements with positive control membranes (E. coli)

  • Statistical analysis using ANOVA with post-hoc tests

These protocols ensure reproducible electron transfer measurements that accurately reflect the native function of YedZ in membrane environments .

How can researchers effectively apply computational modeling to predict substrate specificity of YedZ variants?

Computational modeling for predicting substrate specificity of YedZ variants requires an integrated approach combining structural bioinformatics, molecular dynamics, and machine learning techniques. The following methodological framework provides the most effective predictive power:

  • Structural modeling phase:

    • Homology modeling using multiple templates (minimum 3 structurally diverse homologs)

    • Model refinement through energy minimization and loop optimization

    • Quality assessment using PROCHECK, VERIFY3D, and QMEANDisCo

    • Integration of experimental constraints (if available from crosslinking or spectroscopy)

  • Binding site analysis:

    • Cavity detection algorithms (POCASA, SiteMap, CASTp)

    • Conservation mapping and evolutionary trace analysis

    • Electrostatic potential calculation using adaptive Poisson-Boltzmann solver

    • Identification of key interaction residues using fragment-based approaches

  • Molecular dynamics simulations:

    • System preparation with appropriate membrane embedding (POPC bilayer)

    • Production runs of minimum 100 ns with 2 fs timestep

    • Analysis of binding pocket flexibility and water accessibility

    • Identification of stable conformational states using principal component analysis

  • Substrate docking and interaction scoring:

    • Ensemble docking to multiple receptor conformations

    • Induced-fit docking for flexible substrate accommodation

    • MM-GBSA or FEP calculations for binding energy estimation

    • Validation using experimental mutagenesis data

  • Machine learning integration:

    • Feature extraction from docking poses and molecular descriptors

    • Training set construction from known substrates and non-substrates

    • Model development using random forest, support vector machines, or neural networks

    • Cross-validation and external test set validation

Performance metrics for computational prediction methods include:

MethodAccuracy MetricTypical PerformanceComputational CostKey Advantages
Rigid dockingROC AUC0.65-0.75LowRapid screening of large compound libraries
Flexible dockingEnrichment factor (EF₁₀)3-5×ModerateBetter accommodation of induced fit effects
MD-based approachesBinding free energy correlation (R²)0.5-0.7HighCaptures protein dynamics and water effects
ML consensus modelsMatthews correlation coefficient0.6-0.8Low (prediction) High (training)Integrates multiple descriptors and performs well on diverse substrates

For novel YedZ variants, researchers should implement an iterative approach:

  • Initial computational prediction of specificity shifts

  • Experimental validation with a diverse substrate panel

  • Model refinement based on experimental results

  • Second-round prediction with improved parameters

This systematic approach maximizes the predictive power of computational methods while acknowledging their inherent limitations .

How can researchers overcome difficulties in expressing functional YedZ in heterologous systems?

Expressing functional YedZ in heterologous systems presents several challenges due to its membrane-associated nature and heme cofactor requirement. The following troubleshooting guide addresses common issues and provides methodological solutions:

  • Poor expression levels:

    • Optimize codon usage for the host organism

    • Try different signal sequences (PelB, OmpA, DsbA)

    • Test various promoter strengths (trc, T7, araBAD)

    • Evaluate expression at lower temperatures (16-20°C)

    • Consider specialized expression strains (C41/C43(DE3), Lemo21)

  • Improper membrane insertion:

    • Add fusion partners that assist membrane targeting (Mistic, YidC)

    • Include chaperone co-expression vectors (GroEL/ES, DnaK/J)

    • Implement slow induction protocols using reduced IPTG concentrations

    • Monitor membrane fraction for protein using Western blotting

  • Inefficient heme incorporation:

    • Supplement growth medium with δ-aminolevulinic acid (0.5-1 mM)

    • Co-express heme transporters or biosynthetic enzymes

    • Add hemin to culture medium during induction phase

    • Optimize iron availability in growth medium

  • Protein aggregation and inclusion body formation:

    • Screen various detergents for improved solubilization

    • Implement mild solubilization conditions (0.5-1% detergent, 4°C, overnight)

    • Add stabilizing agents (glycerol, trehalose, specific lipids)

    • Consider refolding protocols specifically designed for membrane proteins

The following decision tree guides systematic troubleshooting:

ProblemDiagnostic TestInterventionExpected Outcome
Low expressionWestern blot of whole cell lysateChange vector and promoter2-5× increase in total protein
Inclusion bodiesMicroscopy and centrifugation testsLower temperature, slower inductionShift from insoluble to membrane fraction
Improper foldingAbsorbance spectrum (absent Soret peak)Chaperone co-expressionAppearance of characteristic heme spectrum
Proteolytic degradationWestern blot shows truncation productsAdd protease inhibitors, use protease-deficient strainsFull-length protein bands
Inactive proteinActivity assay negative despite expressionLipid supplementation, native membrane componentsRestoration of catalytic function

For particularly challenging cases, consider cell-free expression systems with nanodiscs or liposomes for direct incorporation into a membrane environment during translation .

What approaches help resolve inconsistent results in YedZ-substrate binding assays?

Inconsistent results in YedZ-substrate binding assays often stem from technical variations, sample preparation differences, or intrinsic properties of membrane protein-substrate interactions. The following methodological framework helps systematically identify and resolve these inconsistencies:

  • Assay standardization phase:

    • Implement detailed standard operating procedures for all aspects of sample preparation

    • Use internal controls for normalization across experiments

    • Validate assay performance with known standards before testing unknowns

    • Qualify all reagents and establish acceptance criteria for each batch

  • Technical parameter optimization:

    • Determine optimal protein:lipid ratios for membrane reconstitution

    • Establish buffer composition effects on binding parameters

    • Identify temperature dependence of binding equilibria

    • Assess time-dependent stability of protein-substrate complexes

  • Multi-method verification:

    • Compare binding constants across orthogonal techniques (ITC, MST, SPR, fluorescence)

    • Implement binding site mutants as negative controls

    • Use competition assays with known binders to validate specificity

    • Perform saturation binding experiments with varying protein concentrations

  • Data analysis refinement:

    • Apply appropriate binding models (single site, cooperative, multiple independent sites)

    • Use global fitting approaches for datasets from multiple conditions

    • Implement bootstrap analysis for robust parameter estimation

    • Identify and account for non-specific binding components

The following table summarizes method-specific troubleshooting approaches:

MethodCommon IssuesResolution StrategyValidation Approach
Isothermal Titration CalorimetryHeat of dilution interferenceCareful matching of buffer componentsReplicate with different protein concentrations
Microscale ThermophoresisAggregation during temperature gradientAddition of stabilizing agentsLabel-free and labeled protein comparison
Surface Plasmon ResonanceSurface heterogeneityOptimized immobilization and blockingMulti-cycle kinetics with varying flow rates
Fluorescence-based assaysInner filter effectsAbsorbance correction, lower concentrationsExcitation at multiple wavelengths
Equilibrium dialysisMembrane binding to apparatusPre-coating with BSA or detergentRecovery controls with known concentrations

For YedZ specifically, researchers should:

  • Ensure complete heme incorporation before binding studies

  • Account for detergent effects on apparent binding constants

  • Consider potential redox state dependence of substrate affinity

  • Implement controls for non-specific membrane interactions

By systematically addressing these factors, researchers can resolve inconsistencies and establish reproducible binding parameters for YedZ-substrate interactions .

How can researchers troubleshoot problems when integrating YedZ functional studies with broader pathogenicity research?

When troubleshooting integration challenges between YedZ functional studies and broader pathogenicity research, researchers should implement a systematic framework that addresses both molecular-level and system-level inconsistencies. The following approach has proven effective:

  • Experimental design harmonization:

    • Standardize bacterial growth conditions across functional and pathogenicity experiments

    • Implement identical strain backgrounds for molecular and infection studies

    • Use consistent environmental parameters (temperature, pH, media composition)

    • Establish clear phenotypic readouts that bridge molecular function and virulence

  • Technical integration strategies:

    • Develop reporter systems that monitor YedZ activity during infection processes

    • Implement conditional expression systems for temporal control of YedZ function

    • Create isogenic strain sets with defined YedZ variants for comparative virulence assessment

    • Establish sampling protocols that preserve molecular integrity during infection studies

  • Data reconciliation approaches:

    • Apply Bayesian network analysis to integrate functional and pathogenicity datasets

    • Implement mediation analysis to identify causal relationships between YedZ function and virulence

    • Use partial least squares path modeling to quantify direct and indirect effects

    • Develop integrated mathematical models that incorporate molecular mechanisms

  • Validation strategies:

    • Perform complementation studies with well-characterized YedZ variants

    • Implement chemical genetic approaches with specific inhibitors

    • Use heterologous expression systems to isolate YedZ effects

    • Employ trans-species complementation to assess functional conservation

The following decision matrix guides troubleshooting for specific integration challenges:

Integration ChallengeDiagnostic ApproachResolution StrategyExpected Outcome
Inconsistent phenotypes between in vitro and in vivoControlled environment comparisonIdentify host factors affecting functionReconciled molecular and infection phenotypes
YedZ mutation affects multiple pathwaysTranscriptomics of mutant strainsPathway deconvolution analysisIdentification of direct vs. indirect effects
Temporal discrepancies in effectsTime-course experiments with samplingTime-delayed correlation analysisEstablishment of causal sequence
Host response confoundingDual RNA-seq approachesConditional YedZ expression during infectionSeparation of bacterial and host contributions
Strain background effectsPanel testing of YedZ variantsIdentification of genetic modifiersConsistent results across genetic backgrounds

For Erwinia carotovora specifically, researchers should consider:

  • The impact of plant defense responses on YedZ function

  • Potential regulation of YedZ by quorum sensing systems

  • Interaction with other virulence factors like pectinases

  • Environmental conditions relevant to the infection cycle

This structured approach helps resolve discrepancies between molecular mechanisms and pathogenicity observations, leading to a more integrated understanding of YedZ's role in bacterial virulence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.