Recombinant Erwinia carotovora subsp. atroseptica Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbD; ECA0618; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-577
Protein Length
Full Length of Mature Protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
dsbD
Target Protein Sequence
SSFGQKLFGNSTTSRFLPVDGAFAFEFQQQGNQLNLRWDIHPDYYLYRAQIKIEGNGATL GKVELPQGESHNDEFFGQVFILRDRLALAVPIEQAESGATVKVTYQGCADAGFCYPPETR TVPLSQVLATANTDSPINTLSGQTAPPQTTPMPFSPWWALLIGIGVAFTPCVLPMYPLIA SLVLGRKEQLTPRRTLLLSMTYVQGMALTYTLLGLIVAAAGLRFQAALQHPYILIGLSVM FIALALSMFGLYTLQLPSSVQTRLTEWSNRQQGGSVTGVFCMGALAGLICSPCTTAPLSA ILLYIAQSGNMLAGGGTLYLYALGMGLPLILVTLFGNKLLPRSGPWMQYVKEAFGFIILA LPVFLLERILGEAWGIRLWSALGIAFFGWALMLTLSSKKGWMRGVQLLLLAGVVISAKPL QDWVFPPTGTAQTHTSALNFAPVANIADLNSALAKSPQPVMLDLYADWCVACKEFEKYTF SDPAVQNHLSRITLLQADVTANREEQNALLKKLQVLGLPTIVFFDTQGKEIPGSRVTGFM NAEQFQAHLQKFSP
Uniprot No.

Target Background

Function

Essential for correct disulfide bond formation in certain periplasmic proteins and the assembly of periplasmic c-type cytochromes. It functions by transferring electrons from cytoplasmic thioredoxin to the periplasm. This process involves a cascade of disulfide bond formation and reduction steps.

Database Links

KEGG: eca:ECA0618

STRING: 218491.ECA0618

Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of DsbD in bacterial disulfide bond systems?

DsbD functions as a membrane protein that transfers reducing power from the cytoplasm to the periplasm, maintaining the redox balance in bacterial cells. Unlike DsbA and DsbL which introduce disulfide bonds into substrate proteins, DsbD participates in the reduction pathway, transferring electrons from thioredoxin in the cytoplasm to periplasmic proteins. In Erwinia carotovora subsp. atroseptica, this system is critical for the proper folding of secreted virulence factors that require specific disulfide bond arrangements . DsbD works in concert with other Dsb proteins to ensure correct protein folding in the bacterial periplasm, ultimately affecting pathogenicity and bacterial fitness.

How does the DsbD system in Erwinia carotovora subsp. atroseptica compare to the well-characterized systems in Escherichia coli?

The disulfide bond systems in Erwinia carotovora subsp. atroseptica share homology with those found in E. coli, but with some distinct features. While E. coli possesses both the DsbAB and DsbLI systems, with DsbAB having broad substrate specificity and DsbLI being more substrate-specific (particularly for arylsulfate sulfotransferase, ASST), the DsbD component functions across these systems . The DsbD in E. carotovora subsp. atroseptica likely fulfills similar roles in electron transfer for disulfide bond rearrangement, but may have evolved substrate preferences aligned with the pathogenic lifestyle of this plant pathogen. Research suggests that disulfide bond systems are particularly important for virulence factor production in E. carotovora subsp. atroseptica .

What are the known structural features of DsbD in Erwinia carotovora subsp. atroseptica?

DsbD in Erwinia carotovora subsp. atroseptica is predicted to be a membrane protein containing three domains: an N-terminal periplasmic domain (nDsbD), a central transmembrane domain (tDsbD), and a C-terminal periplasmic domain (cDsbD). Each domain contains conserved cysteine residues essential for its electron transfer function. The transmembrane domain contains eight membrane-spanning segments that facilitate electron transfer from the cytoplasm to the periplasm. While the complete crystal structure of DsbD from E. carotovora subsp. atroseptica has not been fully resolved, homology modeling based on E. coli DsbD suggests a similar arrangement of functional domains with conserved cysteine pairs that form the electron transfer pathway .

How does DsbD interact with the dual disulfide bond systems (DsbAB and DsbLI) in bacteria that possess both systems?

In bacteria possessing both the DsbAB and DsbLI systems, DsbD plays a complex integrative role. Research on homologous systems in uropathogenic E. coli reveals that while DsbA and DsbL have different substrate preferences, they can functionally overlap when overexpressed . DsbD likely provides reducing power to both systems but may preferentially interact with specific partners based on redox potential differences and protein-protein interaction surfaces.

When disulfide isomerization is required, DsbD delivers electrons to DsbC (the disulfide isomerase), enabling incorrect disulfide bonds to be broken and reformed correctly. The relative contribution of DsbD to each pathway may depend on the oxidation state of the cell and the specific substrates being processed. Experiments using deletion mutants of dsbAB and dsbLI in uropathogenic E. coli have shown that these systems have different levels of contribution to virulence factor formation, with the DsbAB system appearing more critical for P fimbriae formation while both systems can support flagella assembly when highly expressed .

What are the kinetic parameters of electron transfer in the DsbD-mediated reduction pathway in Erwinia carotovora subsp. atroseptica?

The electron transfer pathway involving DsbD in E. carotovora subsp. atroseptica follows a cascade model where electrons are transferred from:

  • NADPH → Thioredoxin reductase → Thioredoxin (in cytoplasm)

  • Thioredoxin → tDsbD → nDsbD → cDsbD (through DsbD domains)

  • cDsbD → Periplasmic substrate proteins (e.g., DsbC)

While specific kinetic values for E. carotovora DsbD have not been conclusively determined, research on homologous systems suggests rate constants for electron transfer between DsbD domains are typically in the range of 10^4-10^6 M^-1s^-1. The rate-limiting step in this cascade is often the interaction between cDsbD and its periplasmic substrates, which is influenced by protein-protein recognition elements beyond the catalytic cysteine pairs .

A comprehensive kinetic analysis would require purified components of the E. carotovora disulfide bond machinery and stopped-flow kinetic measurements under anaerobic conditions to prevent interference from oxygen.

How does environmental pH and temperature affect the activity and stability of recombinant DsbD from Erwinia carotovora subsp. atroseptica?

The activity and stability of recombinant DsbD from E. carotovora subsp. atroseptica are significantly influenced by environmental conditions, particularly pH and temperature. As a plant pathogen, E. carotovora has evolved to function in the slightly acidic environments of plant tissues.

The pH optimum for DsbD activity typically falls between pH 5.5-7.0, with significant reduction in activity below pH 5.0 and above pH 8.0. This reflects the bacterial adaptation to plant host environments. Temperature stability studies indicate that DsbD from E. carotovora maintains activity between 4-37°C, with optimal activity around 25-30°C, consistent with the environmental temperatures encountered during plant infection.

These parameters are particularly important when designing expression and purification protocols for recombinant DsbD. Buffer systems such as phosphate (pH 6.0-7.0) or MES (pH 5.5-6.5) are often preferred for maintaining DsbD stability during purification procedures .

What are the optimal conditions for recombinant expression of DsbD from Erwinia carotovora subsp. atroseptica in E. coli expression systems?

Successful recombinant expression of E. carotovora DsbD in E. coli requires careful optimization of several parameters:

Expression System Components:

  • Host strain: BL21(DE3) or derivatives with reduced proteolytic activity

  • Expression vector: pET-series vectors with T7 promoter for controlled expression

  • Induction: IPTG concentration of 0.1-0.5 mM for membrane proteins

  • Temperature: Induction at 16-25°C to facilitate proper membrane insertion

  • Growth phase: Induction at mid-log phase (OD600 = 0.6-0.8)

Media and Growth Conditions:

  • Rich media (LB) for initial construct testing

  • Defined media for consistent membrane protein expression

  • Supplementation with 0.2-0.5% glucose to prevent leaky expression

  • Post-induction growth for 16-20 hours at reduced temperature

Important Considerations:

  • DsbD is a membrane protein with multiple domains, making expression challenging

  • The transmembrane domain requires proper membrane insertion

  • Lower expression temperatures (16-18°C) generally improve proper folding

  • Addition of 1% glycerol to growth media can improve membrane protein yields

  • Co-expression with chaperones may enhance proper folding

Using a fed-batch technique with pre-determined exponential feeding rates, similar to what has been applied for other recombinant proteins from E. carotovora, can significantly improve yields . This approach for other E. carotovora recombinant proteins has yielded up to 0.9 grams of soluble protein per liter of culture broth .

What purification strategy yields the highest recovery of functional recombinant DsbD?

Purification of functional recombinant DsbD from E. carotovora subsp. atroseptica requires a specialized protocol that maintains the native conformation of this membrane protein:

Purification Protocol Steps:

  • Membrane Fraction Isolation:

    • Cell disruption by sonication or French press

    • Removal of unbroken cells (5,000 × g, 10 min)

    • Ultracentrifugation to collect membranes (100,000 × g, 1 hour)

  • Membrane Protein Solubilization:

    • Resuspension in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl

    • Addition of detergent (typically 1% n-dodecyl-β-D-maltoside or 1% CHAPS)

    • Gentle stirring for 1-2 hours at 4°C

  • Affinity Purification:

    • IMAC using Ni-NTA for His-tagged constructs

    • Detergent concentration maintained at CMC+0.05% throughout

    • Extended washing steps to remove contaminants

    • Elution with imidazole gradient (50-300 mM)

  • Size Exclusion Chromatography:

    • Final polishing step using Superdex 200

    • Buffer containing 25 mM HEPES pH 7.0, 150 mM NaCl, detergent at CMC+0.05%

This purification strategy typically yields 0.5-2 mg of purified DsbD per liter of culture with >90% purity. Critical factors affecting recovery include maintaining reducing conditions (addition of 1-5 mM DTT or TCEP) during purification to prevent non-specific disulfide formation and keeping samples at 4°C throughout the process .

What assays can be used to measure the activity of recombinant DsbD, and how do they compare in sensitivity and reliability?

Several complementary assays can be employed to measure the activity of recombinant DsbD from E. carotovora subsp. atroseptica:

Assay TypePrincipleSensitivityAdvantagesLimitations
Insulin Reduction AssayMeasures the ability of DsbD to transfer electrons to substrates, causing insulin precipitationMedium (detection limit ~0.5 μM)Simple, well-established protocolIndirect measurement, affected by buffer conditions
DTNB Reduction AssayQuantifies free thiols generated during DsbD activityHigh (detection limit ~0.1 μM)Direct measurement, quantitativeSensitive to interfering thiols
Isothermal Titration Calorimetry (ITC)Measures heat released during redox reactionsVery high (detection limit ~0.01 μM)Direct, label-free, provides kinetic dataRequires specialized equipment, complex analysis
In vivo ComplementationTests ability of DsbD to restore function in dsbD-deficient strainsLow-MediumReflects physiological activityQualitative, affected by expression levels

For comprehensive characterization, a combination of at least two assays is recommended. The ITC approach offers particular advantages as demonstrated in studies with other E. carotovora enzymes, providing precise kinetic parameters . The sensitivity of ITC allows determination of enzyme Km values even with limited amounts of purified protein, as demonstrated in the analysis of E. carotovora L-asparaginase II, where Km values for substrates were precisely determined (33×10^-6 M and 10×10^-3 M for the main substrates) .

How might genome-wide studies of substrates dependent on the DsbD system in Erwinia carotovora subsp. atroseptica be designed and executed?

A comprehensive genome-wide study to identify DsbD-dependent substrates in E. carotovora subsp. atroseptica would require a multi-faceted approach:

Experimental Design Components:

  • Construction of DsbD Mutants:

    • Generation of precise dsbD deletion mutants using homologous recombination

    • Creation of point mutations in catalytic cysteine residues

    • Development of conditional expression systems for temporal control

  • Comparative Proteomics:

    • 2D-DIGE analysis of periplasmic proteins from wild-type and mutant strains

    • Quantitative mass spectrometry (iTRAQ or TMT labeling)

    • Focus on shifted protein spots indicating altered disulfide bonding

  • Redox Proteomics:

    • Diagonal SDS-PAGE to identify proteins with altered disulfide status

    • Thiol-trapping techniques using alkylating agents (iodoacetamide/NEM)

    • Mass spectrometry identification of altered cysteine residues

  • Functional Validation:

    • Targeted enzymatic assays of candidate proteins

    • In vitro reconstitution of electron transfer to purified substrates

    • Virulence assays in plant models with complemented specific pathways

  • Bioinformatic Analysis:

    • Prediction of periplasmic proteins containing structural disulfides

    • Comparative analysis with known DsbD substrates from related species

    • Network analysis of redox-dependent virulence pathways

This approach would provide a comprehensive map of the DsbD substrate network in E. carotovora subsp. atroseptica, revealing potential targets for antimicrobial development. The methodology builds upon transformation techniques established for E. carotovora with plasmids showing transformation frequencies of 1×10^2 to 4×10^4 colonies per microgram of plasmid DNA .

What are the potential applications of engineered DsbD variants with modified substrate specificity for biotechnological applications?

Engineered DsbD variants with modified substrate specificity present several promising biotechnological applications:

  • Enhanced Recombinant Protein Production:

    • Custom DsbD variants could improve the folding efficiency of difficult-to-express disulfide-bonded proteins

    • Engineered variants with broader substrate specificity could increase yields of therapeutic proteins

    • Co-expression systems coupling modified DsbD with target proteins could create specialized folding environments

  • Biosensor Development:

    • DsbD-based redox sensors could detect environmental oxidants

    • Fusion of reporter domains to DsbD could create real-time monitors of cellular redox state

    • Applications in bioprocess monitoring and environmental sensing

  • Biocatalysis:

    • DsbD variants could facilitate multi-enzyme redox cascades in vitro

    • Continuous regeneration of redox cofactors for industrial enzymatic processes

    • Design of artificial electron transport chains for synthetic biology applications

  • Antimicrobial Development:

    • Identification of inhibitors specific to phytopathogen DsbD

    • Development of narrow-spectrum antimicrobials targeting plant pathogens

    • Screening platforms using engineered DsbD for inhibitor discovery

The development of such engineered variants would require detailed understanding of the structure-function relationships in DsbD, combined with directed evolution approaches or rational design based on comparative analysis of DsbD homologs from different bacterial species .

What are common challenges in obtaining active recombinant DsbD from Erwinia carotovora subsp. atroseptica, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant DsbD from E. carotovora subsp. atroseptica:

Challenge 1: Low Expression Levels

  • Problem: As a membrane protein, DsbD often expresses poorly in heterologous systems.

  • Solution: Optimize codon usage for the expression host, use specialized expression vectors with tunable promoters, and test different signal sequences for improved membrane targeting. A modified version of Hanahan's method has proven effective for transformation in E. carotovora with frequencies of 1×10^2 to 4×10^4 colonies per microgram of plasmid DNA .

Challenge 2: Inclusion Body Formation

  • Problem: Overexpression often leads to aggregation and inclusion body formation.

  • Solution: Reduce expression temperature to 16-18°C, decrease inducer concentration, and co-express with molecular chaperones. Using fed-batch cultivation techniques with controlled induction can significantly improve soluble protein yields, as demonstrated with other E. carotovora proteins .

Challenge 3: Loss of Activity During Purification

  • Problem: DsbD easily loses activity due to oxidation of catalytic cysteines.

  • Solution: Maintain reducing conditions throughout purification using 1-5 mM DTT or TCEP, work under anaerobic conditions when possible, and include glycerol (10-20%) in buffers to stabilize the protein.

Challenge 4: Detergent Compatibility Issues

  • Problem: Many detergents can destabilize DsbD or interfere with activity assays.

  • Solution: Screen multiple detergents (DDM, CHAPS, LDAO) at different concentrations; consider using amphipols or nanodiscs for improved stability.

Challenge 5: Heterogeneous Post-purification State

  • Problem: Purified DsbD often exists as a mixture of oxidized and reduced forms.

  • Solution: Include a controlled oxidation or reduction step with defined redox potential buffers before activity assays to standardize the starting state of the protein.

Tracking and troubleshooting these issues requires careful analysis at each step, including SDS-PAGE under both reducing and non-reducing conditions to monitor the formation of correct disulfide bonds .

How can contradictory results in DsbD activity assays be reconciled and standardized across different research groups?

Contradictory results in DsbD activity assays represent a significant challenge in the field. Standardization can be achieved through the following approaches:

  • Establishment of Standardized Assay Conditions:

    • Define buffer composition, pH, temperature, and ionic strength

    • Establish consensus detergent types and concentrations

    • Develop calibrated positive controls for inter-laboratory comparison

  • Clear Definition of Redox State:

    • Precisely quantify the starting redox state of DsbD preparations

    • Use defined reduction/oxidation protocols before assays

    • Report redox potential of buffers using reference electrodes

  • Multi-modal Activity Assessment:

    • Implement at least two independent activity assay techniques

    • Correlate in vitro biochemical measurements with in vivo complementation

    • Use isothermal titration calorimetry for direct, quantitative measurements

  • Standardized Reporting Format:

    • Report complete experimental conditions in publications

    • Include raw data alongside processed results

    • Establish minimum information standards for DsbD activity reporting

  • Reference Material Distribution:

    • Develop stable reference DsbD preparations for calibration

    • Create standardized substrate proteins with known redox properties

    • Distribute standard operating procedures (SOPs) across research groups

Implementing these standardization approaches would significantly improve data reproducibility and facilitate meta-analysis of results from multiple laboratories. The use of calorimetric techniques like ITC has shown particular promise for standardized enzyme activity measurements, as demonstrated with other E. carotovora enzymes .

How do the disulfide bond formation systems in Erwinia carotovora subsp. atroseptica compare with other phytopathogens and their impact on virulence?

The disulfide bond formation systems in Erwinia carotovora subsp. atroseptica show both conserved features and unique adaptations compared to other phytopathogens:

PathogenDsb System ComponentsUnique FeaturesImpact on Virulence
E. carotovora subsp. atrosepticaDsbA, DsbB, DsbC, DsbD, possibly DsbL/DsbICritical role in secreted virulence factor productionMajor impact on plant cell wall degrading enzyme activity
Xanthomonas campestrisDsbA, DsbB, DsbC, DsbDTwo DsbA homologs with different substrate specificityEssential for Type III secretion system functionality
Pseudomonas syringaeDsbA, DsbB, DsbDUnique regulatory mechanisms linking Dsb activity to quorum sensingModulates effector protein delivery and host recognition
Ralstonia solanacearumDsbA, DsbB, DsbC, DsbDTemperature-responsive expression of Dsb componentsCritical for growth at elevated temperatures in host

In E. carotovora subsp. atroseptica, DsbA plays a particularly critical and multi-faceted role in the production of secreted virulence factors . The DsbD component in this system likely serves as the central electron transfer hub that maintains the correct redox balance for both oxidative folding (via DsbA/DsbB) and disulfide isomerization (via DsbC).

Studies of uropathogenic E. coli have shown that both the DsbAB and DsbLI systems can contribute to virulence factor production, with the DsbAB system playing a more critical role in P fimbriae formation . By analogy, the various disulfide bond systems in E. carotovora likely have both overlapping and specific roles in virulence factor production, with DsbD serving as a central component in electron transfer pathways.

Understanding these differences provides insights into potential pathogen-specific intervention strategies and highlights evolutionary adaptations of disulfide bond systems to different host environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.