Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase (uppP)

Erwinia carotovora subsp. atroseptica is a phytopathogen known for its ability to degrade plant cell walls via secreted enzymes. The recombinant Undecaprenyl-diphosphatase (uppP) is a critical enzyme in bacterial cell envelope synthesis, specifically involved in converting undecaprenyl pyrophosphate (UPP) to undecaprenyl monophosphate (Und-P), a precursor for peptidoglycan and teichoic acid biosynthesis . This enzyme is also linked to bacitracin resistance, as its activity counteracts the antibiotic’s disruption of UPP recycling .

Functional Role and Mechanism

UppP belongs to the UPP phosphatase family, which is essential for bacterial cell envelope integrity. Its primary role includes:

  • Catalyzing UPP to Und-P: Enables precursor recycling for peptidoglycan synthesis and wall teichoic acid production .

  • Bacitracin Resistance: Bacitracin inhibits UPP recycling; uppP activity circumvents this by maintaining Und-P availability .

  • Cellular Stress Response: Depletion of UPP phosphatases (e.g., in Bacillus subtilis) triggers σᴍ-mediated stress responses, indicating a conserved role in envelope homeostasis .

In E. carotovora, uppP’s activity may intersect with virulence pathways, as cell envelope stability is critical for pathogen survival in host environments .

Comparative Analysis with Related Enzymes

EnzymeFunctionInteraction with uppP
UppSUndecaprenyl pyrophosphate synthaseCollaborates in UPP synthesis
BcrCAlternative UPP phosphatase (in B. subtilis)Redundant to uppP in cell envelope synthesis
YodMPredicted lipid phosphataseOverexpression compensates for uppP/BcrC loss in B. subtilis

UppP’s activity is distinct from other phosphatases like YodM, which lacks inherent UPP specificity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; ECA3589; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
uppP
Target Protein Sequence
MTDLHSLLIAFILGVVEGLTEFLPVSSTGHMIIVGHWLGFVDEKAKTFEVIIQLGSILAV VVMFWRRLFGLIGIHFGKVPHEGKTSGRLKLTHILLAMIPAVVLGLIFHDVIKSLFYPQN VMYSLVIGGFLLLAAEWFKPKEPRAVGLDDITHRQAFMIGCFQCLALWPGFSRSGATISG GMLMGVSRYAASEFSFILAVPMMMGATVLDLYKSWHFLSLADVPMFAVGFVTAFVVALIA IKTFLKIIKRISFIPFAIYRFIVAGVVYMVFM
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: eca:ECA3589

STRING: 218491.ECA3589

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (uppP) is an enzyme that plays a crucial role in bacterial cell wall biosynthesis. It is also known as bacitracin resistance protein or undecaprenyl pyrophosphate phosphatase, as indicated in the protein annotation information . The enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate to produce undecaprenyl phosphate, which serves as a lipid carrier for the transportation of peptidoglycan precursors across the bacterial cell membrane .

The reaction catalyzed by uppP is a critical recycling step in the peptidoglycan synthesis pathway. After the peptidoglycan precursors are transferred to the growing cell wall, undecaprenyl diphosphate is released. The uppP enzyme then removes one phosphate group, regenerating undecaprenyl phosphate, which can again participate in the transport of new peptidoglycan precursors.

The importance of this enzymatic reaction is highlighted by the fact that dephosphorylation of undecaprenyl diphosphate is considered a crucial step in the synthesis of undecaprenyl phosphate, which is essential for cell wall synthesis . Without this recycling mechanism, bacteria would quickly deplete their supply of lipid carriers, bringing cell wall synthesis to a halt.

What are the optimal storage and handling conditions for Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase?

Proper storage and handling of Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase is critical for maintaining its enzymatic activity and structural integrity. According to product specifications, the following conditions are recommended:

The recombinant protein should be stored in a Tris-based buffer containing 50% glycerol, which has been specifically optimized for this protein . For short-term storage up to one week, the protein can be kept at 4°C. For longer-term storage, the protein should be maintained at -20°C, while extended storage periods require conservation at either -20°C or -80°C .

It is particularly important to note that repeated freezing and thawing cycles should be avoided as they can significantly degrade the protein's quality and reduce its enzymatic activity . To minimize this issue, researchers should prepare working aliquots upon first thawing the protein stock.

When handling the protein for experimental procedures:

  • Use sterile techniques to prevent microbial contamination

  • Thaw frozen aliquots slowly on ice

  • Avoid vigorous shaking or vortexing that might denature the protein

  • Maintain appropriate buffer conditions throughout experimental procedures

  • Consider including protease inhibitors if working with cell lysates

Following these guidelines will help ensure reproducible results when working with this enzyme in research applications.

What expression systems are recommended for producing Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase?

Escherichia coli is the most commonly used and recommended expression system for producing recombinant proteins from Erwinia species, including Undecaprenyl-diphosphatase from Erwinia carotovora subsp. atroseptica. Recent optimization studies with recombinant Erwinia carotovora enzymes in E. coli have demonstrated that fed-batch cultivation strategies in benchtop bioreactors can achieve high yields of functional protein .

For optimal production, the DO-stat feeding strategy with induction at 18 hours of culture has shown particularly promising results. Under these experimental conditions, studies with another Erwinia carotovora recombinant enzyme achieved maximum values for yield per substrate, yield per biomass, and productivity of approximately 1204 U/g glucose, 3660 U/g cells, and 3260 U/(L·h), respectively . Similar strategies would likely be effective for Undecaprenyl-diphosphatase expression.

For genetic manipulation of Erwinia carotovora subsp. atroseptica itself, a modified version of the Hanahan method has proven successful for transformation. This approach has yielded transformation frequencies ranging from 1 × 10² to 4 × 10⁴ colonies per microgram of plasmid DNA when using plasmids such as pBR322, pBR325, and pAT153 . ColE1-based plasmids have been identified as particularly useful cloning vectors for studying genes involved in Erwinia pathogenesis .

The expression vector design should consider:

  • Appropriate promoter strength (typically IPTG-inducible for controlled expression)

  • Inclusion of affinity tags for purification (while considering their potential impact on activity)

  • Codon optimization for the expression host

  • Signal sequences if secretion is desired

How can I quantify undecaprenyl diphosphate and undecaprenyl phosphate in bacterial cell extracts?

Quantifying undecaprenyl diphosphate and undecaprenyl phosphate in bacterial cell extracts requires specialized analytical methods due to their chemical properties and low cellular abundance. A recently developed approach addresses these challenges through a multi-step process :

  • Preparation of Standards:

    • Polyprenyl phosphates and diphosphates can be prepared by chemical phosphorylation of polyprenols from sources such as Staphylococcus aureus

    • These standards establish conditions for fractionation by ion-exchange chromatography and high-performance liquid chromatography (HPLC)

  • Extraction Protocol:

    • Harvest bacterial cells at appropriate growth phase

    • Extract cellular lipids using optimized extraction methods

    • Fractionate the extract to separate polyprenyl compounds

  • Chromatographic Analysis:

    • Employ ion-exchange chromatography for initial separation

    • Use reversed-phase HPLC with an elution solvent containing tetraethylammonium phosphate as an ion-pair reagent

    • This specialized approach allows detection of polyprenyl phosphate and polyprenyl diphosphate with carbon numbers from 40 to 55 as separate, distinct peaks

The analytical methodology described represents a significant advancement, as it enables the separate measurement of cellular levels of polyprenyl phosphates and polyprenyl diphosphates, which had not previously been directly measured . This approach can be applied to determine the intracellular levels of octaprenyl phosphate, undecaprenyl phosphate, octaprenyl diphosphate, and undecaprenyl diphosphate in bacterial cells.

For researchers studying Undecaprenyl-diphosphatase activity, this method provides a powerful tool to directly observe substrate consumption and product formation under various experimental conditions, offering more comprehensive insights than traditional indirect assays.

How should I design experiments to study the kinetic properties of Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase?

Designing rigorous experiments to characterize the kinetic properties of Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase requires careful consideration of variables, controls, and analytical methods. Following experimental design principles, researchers should implement this systematic approach :

Step 1: Define Your Research Variables

  • Independent variable: Substrate (undecaprenyl diphosphate) concentration

  • Dependent variable: Enzyme activity (rate of phosphate release)

  • Controlled variables: Temperature, pH, buffer composition, enzyme concentration

  • Potential confounding variables: Detergent concentration, divalent cation presence, substrate solubility

Step 2: Formulate Testable Hypotheses
Develop specific hypotheses about the enzyme's kinetic behavior, such as:

  • The enzyme follows Michaelis-Menten kinetics

  • Specific pH/temperature optima exist for catalytic activity

  • Certain ions enhance or inhibit enzyme function

Step 3: Design Methodological Approach
For basic kinetic characterization:

  • Reaction Setup:

    • Prepare a series of reactions containing constant enzyme concentration and varying substrate concentrations

    • Include appropriate controls (no enzyme, no substrate)

    • Ensure all reactions maintain identical conditions except for the variable being tested

  • Data Collection:

    • Measure initial reaction rates (before 10% of substrate is consumed)

    • Collect multiple replicates at each condition

    • Use appropriate time points to ensure linear reaction progression

  • Analysis Method:

    • Plot reaction velocity versus substrate concentration

    • Fit data to appropriate kinetic models (Michaelis-Menten, Hill equation, etc.)

    • Extract kinetic parameters (Km, Vmax, kcat, kcat/Km)

Example Experimental Design Table:

ParameterValues/Conditions to TestMeasurement MethodExpected Outcome
Substrate concentration0-100 μM in 10-15 incrementsHPLC quantificationMichaelis-Menten curve
pH optimumpH 5.0-9.0 in 0.5 incrementsPhosphate release assayBell-shaped curve
Temperature effect20-50°C in 5°C incrementsPhosphate release assayTemperature-activity profile
Divalent cation effectsMg²⁺, Ca²⁺, Zn²⁺, Mn²⁺ at 1-5 mMComparative activity assayIdentification of cofactors

This systematic approach will yield reliable kinetic parameters that characterize the catalytic properties of Undecaprenyl-diphosphatase, providing insights into its mechanistic function and potential regulation in bacterial cell wall synthesis .

What approaches should I use when faced with data that contradicts expected results for Undecaprenyl-diphosphatase activity?

When confronted with experimental data that contradicts expected results regarding Undecaprenyl-diphosphatase activity, researchers should implement a structured approach to investigate the discrepancies rather than dismissing unexpected findings. Such contradictions often lead to valuable insights when systematically examined .

Step 1: Thorough Data Examination
Begin by comprehensively examining your data to identify specific patterns of contradiction . Create a detailed comparison between expected and observed results:

ParameterExpected ResultObserved ResultDegree of Divergence
Enzyme Activity (units/mg)[Expected value][Observed value][% difference]
Substrate Specificity[Expected pattern][Observed pattern][Qualitative assessment]
pH Optimum[Expected pH][Observed pH][pH units difference]
Inhibitor Sensitivity[Expected IC50][Observed IC50][Fold difference]

Pay particular attention to outliers and unexpected trends that may provide clues to underlying mechanisms or methodological issues .

Step 2: Methodological Validation
When studying membrane-associated enzymes like Undecaprenyl-diphosphatase, several technical factors may contribute to unexpected results:

  • Protein Preparation Assessment:

    • Verify protein folding and integrity through circular dichroism or fluorescence spectroscopy

    • Confirm membrane incorporation if using reconstituted systems

    • Check for potential post-translational modifications

  • Assay Validation:

    • Verify substrate purity and identity using mass spectrometry

    • Test for potential interfering compounds in reaction mixtures

    • Validate detection methods with appropriate standards

Step 3: Alternative Hypothesis Generation
By conducting a comprehensive analysis, researchers can develop alternative explanations for contradictory data :

  • Biochemical Mechanisms:

    • Is there allosteric regulation not previously identified?

    • Could there be multiple substrate binding sites with different affinities?

    • Might the enzyme have secondary catalytic activities?

  • Experimental Factors:

    • Are detergent effects influencing enzyme behavior?

    • Could lipid composition be affecting enzyme activity?

    • Is the recombinant protein structurally different from native enzyme?

Step 4: Targeted Validation Experiments
Design focused experiments to test your alternative hypotheses:

  • If allosteric regulation is suspected, perform activity assays with potential effector molecules

  • If detergent effects are implicated, test a panel of different detergents

  • If substrate preparation is questioned, try alternative synthesis methods

By embracing contradictory data as an opportunity for discovery rather than an experimental failure, researchers can gain deeper insights into the complex behavior of Undecaprenyl-diphosphatase and potentially identify novel regulatory mechanisms or structural features .

What is the relationship between Undecaprenyl-diphosphatase activity and bacterial antibiotic resistance?

Undecaprenyl-diphosphatase plays a significant role in bacterial antibiotic resistance, particularly against compounds that target cell wall biosynthesis. Understanding this relationship provides valuable insights for both basic microbiology research and potential therapeutic development.

Undecaprenyl-diphosphatase (uppP) is also known as "bacitracin resistance protein" , a name that directly highlights its role in antibiotic resistance. This nomenclature is not coincidental but reflects a fundamental mechanism by which bacteria can resist certain antibiotics.

Mechanistic Basis of Resistance:

The relationship between uppP and antibiotic resistance centers on the critical role of undecaprenyl phosphate recycling in cell wall biosynthesis:

  • Target Pathway: Bacitracin and certain other antibiotics bind to undecaprenyl diphosphate, preventing its dephosphorylation and thus blocking the regeneration of undecaprenyl phosphate carrier

  • Resistance Mechanism: Increased expression or activity of Undecaprenyl-diphosphatase can overcome this inhibition by:

    • Accelerating the conversion of undecaprenyl diphosphate to undecaprenyl phosphate

    • Reducing the pool of undecaprenyl diphosphate available for antibiotic binding

    • Ensuring sufficient undecaprenyl phosphate for continued cell wall synthesis

Recent methodological advances that allow direct measurement of undecaprenyl diphosphate and undecaprenyl phosphate levels in bacterial cells provide a powerful tool for investigating how uppP activity correlates with antibiotic resistance phenotypes. By quantifying these lipid intermediates under various conditions, researchers can establish direct links between enzyme activity, substrate/product levels, and antibiotic susceptibility.

Research Implications:

Studying the relationship between Undecaprenyl-diphosphatase activity and antibiotic resistance in Erwinia carotovora subsp. atroseptica can:

  • Provide insights into intrinsic resistance mechanisms in this plant pathogen

  • Identify potential synergistic combinations of antibiotics that might target both the enzyme and other cell wall synthesis components

  • Guide the development of novel enzyme inhibitors that could potentially restore sensitivity to existing antibiotics

This research area represents an important intersection of basic enzymology and applied antimicrobial research, with potential applications in both agricultural and clinical settings.

How can I use genetic modification techniques to study the function of Undecaprenyl-diphosphatase in Erwinia carotovora subsp. atroseptica?

Genetic modification provides powerful approaches to investigate the physiological role and regulation of Undecaprenyl-diphosphatase in Erwinia carotovora subsp. atroseptica. Several techniques can be employed, leveraging established transformation methods for this organism.

Transformation Methodology:

Efficient transformation of Erwinia carotovora subsp. atroseptica can be achieved using a modified version of the Hanahan method, which has demonstrated transformation frequencies ranging from 1 × 10² to 4 × 10⁴ colonies per microgram of plasmid DNA with plasmids such as pBR322, pBR325, and pAT153 . This established transformation protocol provides the foundation for various genetic manipulation approaches.

Gene Expression Manipulation Strategies:

  • Gene Knockout/Knockdown Studies:

    • Design knockout constructs containing antibiotic resistance markers flanked by homologous regions to the uppP gene

    • Transform E. carotovora subsp. atroseptica using the modified Hanahan method

    • Select for double crossover events that replace the native gene

    • If uppP is essential, consider conditional approaches such as:

      • Inducible promoter replacement

      • Antisense RNA expression

      • CRISPR interference (CRISPRi)

  • Overexpression Systems:

    • Clone the uppP gene into expression vectors suitable for Erwinia

    • Transform using established protocols

    • Induce overexpression under controlled conditions

    • Assess phenotypic consequences, particularly regarding cell wall integrity and antibiotic resistance

  • Reporter Gene Fusions:

    • Create transcriptional or translational fusions between uppP regulatory elements and reporter genes

    • Monitor expression under various environmental conditions

    • Identify factors that regulate uppP expression

Experimental Design Table for Genetic Studies:

Genetic ApproachKey ComponentsExpected OutcomeAnalysis Methods
Conditional knockdownInducible promoter controlling uppPGrowth defects upon repressionGrowth curves, microscopy, cell wall analysis
Site-directed mutagenesisModified catalytic residuesAltered enzyme activityEnzyme assays, antibiotic sensitivity
Promoter-reporter fusionuppP promoter + GFP/luciferaseExpression pattern dataFluorescence/luminescence measurements
ComplementationE. coli uppP mutant + Erwinia uppPFunctional validationGrowth restoration, enzyme activity

ColE1-based plasmids have been specifically recommended for studying genes involved in the pathogenesis of Erwinia species , making them appropriate vectors for these genetic studies. Through these approaches, researchers can systematically investigate the physiological role, regulation, and importance of Undecaprenyl-diphosphatase in Erwinia carotovora subsp. atroseptica, providing insights into its contribution to cell wall biosynthesis and potential role in pathogenicity.

How can I develop and validate an inhibitor screening assay for Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase?

Developing a robust inhibitor screening assay for Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase requires careful consideration of enzyme properties, substrate accessibility, and detection methods. Here is a comprehensive approach to establishing and validating such an assay:

Assay Development Strategy:

  • Enzyme Preparation:

    • Express and purify Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-diphosphatase with appropriate tags

    • Verify enzyme purity by SDS-PAGE and activity by phosphate release assays

    • Determine optimal storage conditions to maintain stability (50% glycerol, Tris-based buffer)

  • Substrate Considerations:

    • Chemically synthesize or isolate undecaprenyl diphosphate substrate

    • Consider using fluorescent or radiolabeled substrates for enhanced sensitivity

    • For initial screening, synthetic substrate analogs with improved solubility may be used

  • Assay Format Selection:

    • For high-throughput screening: microplate-based format with colorimetric phosphate detection

    • For detailed characterization: HPLC-based assay using the ion-pair reagent method that can separate and quantify both substrate and product

Assay Validation Requirements:

  • Statistical Parameters:

    • Calculate Z'-factor (aim for >0.5 for a robust assay)

    • Determine signal-to-background ratio (aim for >5)

    • Establish inter-day and intra-day variability (<15%)

  • Controls:

    • Positive control: Known phosphatase inhibitors (even if not specific to uppP)

    • Negative control: Vehicle (DMSO) only

    • Background control: No enzyme reaction

  • Counter-screening:

    • Test hits against other phosphatases to assess selectivity

    • Evaluate for potential interference with the detection method

Validation Experiments Table:

Validation ParameterExperimental ApproachAcceptance Criteria
LinearityVarying enzyme concentrationsR² > 0.95 over working range
ReproducibilityReplicate testing of controlsCV < 15%
DMSO toleranceVarying DMSO concentrations<20% activity loss at screening concentration
Thermal shift assayCompound binding verificationShift in protein melting temperature
Mechanism evaluationEnzyme kinetics with inhibitorsDetermination of Ki and inhibition mode

By developing and validating a robust screening assay, researchers can identify potential inhibitors of Undecaprenyl-diphosphatase that could serve as chemical probes for studying enzyme function or as starting points for developing new antibacterial agents targeting cell wall biosynthesis in Erwinia carotovora subsp. atroseptica and related bacterial pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.