Recombinant Erwinia carotovora subsp. atroseptica Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
arnC; ECA3145; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
arnC
Target Protein Sequence
MIDDIKNVSVVIPVYNEEESLPVLIERTLAACRKIGKPWEIILVDDGSNDRSAELLTEAA SDPEKHIIAVLLNRNYGQHSAIMAGFQQAVGDVVITLDADLQNPPEEIPRLVEYASQGYD VVGTVRANRQDSLFRKLASKTINMMIRRSTGKSMADYGCMLRAYRRHIVSAMLRCHERST FIPILANTFARKTIEIDVLHAEREFGTSKYSFLKLINLMYDLLTCLTTTPLRILSLIGSV VALSGFLLALLLIGLRLFFGAEWAAEGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYTDV RARPRYFVQKTVSAATPLTTSLRDEEE
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A and is essential for bacterial resistance to polymyxin and other cationic antimicrobial peptides.

Database Links

KEGG: eca:ECA3145

STRING: 218491.ECA3145

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in Erwinia carotovora?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in Erwinia carotovora catalyzes the critical transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This enzymatic reaction represents a key step in lipopolysaccharide (LPS) modification pathways that alter the bacterial outer membrane composition. The modified arabinose subsequently becomes attached to lipid A components of the bacterial outer membrane, significantly altering surface charge characteristics. This modification is fundamental to the bacterium's resistance mechanisms against cationic antimicrobial peptides and polymyxin antibiotics, allowing the organism to survive in hostile environments .

The arnC gene is part of the larger arn operon (sometimes referred to as pmr operon in other species), which encodes multiple enzymes involved in arabinose modification of lipid A. The complete pathway includes synthesis of the arabinose donor molecule, its attachment to the undecaprenyl carrier, and final transfer to lipid A. Functional analysis of arnC reveals its essential role in maintaining membrane integrity and contributing to bacterial virulence and survival during host infection or environmental stress.

How does the amino acid sequence and structural characteristics of arnC relate to its enzymatic function?

The full amino acid sequence of Erwinia carotovora subsp. atroseptica arnC protein consists of 327 amino acids with distinctive functional domains that directly relate to its catalytic activity . The protein contains characteristic glycosyltransferase domains responsible for substrate binding and catalysis. The N-terminal region (approximately amino acids 1-150) forms a nucleotide-sugar binding domain that recognizes the UDP-4-deoxy-4-formamido-L-arabinose substrate, while the central and C-terminal regions facilitate binding of the undecaprenyl phosphate acceptor.

Multiple sequence alignment analysis with arnC homologs from other bacterial species reveals several highly conserved motifs, particularly in the catalytic core. Key conserved residues include aspartic acid residues involved in metal coordination and catalysis, as well as positively charged amino acids that interact with the phosphate groups of the substrates. The protein also contains transmembrane domains in its C-terminal region (approximately amino acids 230-320) that anchor it to the cytoplasmic membrane, positioning the catalytic domain to access both cytoplasmic substrates and membrane-embedded undecaprenyl phosphate .

DomainPosition (aa)Function
N-terminal1-150Nucleotide-sugar binding, UDP-Ara4FN recognition
Central151-230Catalytic activity, metal coordination
C-terminal231-327Transmembrane anchoring, undecaprenyl phosphate binding

What are the optimal conditions for expressing and purifying recombinant arnC from Erwinia carotovora?

Successful expression and purification of recombinant arnC from Erwinia carotovora requires careful optimization of multiple parameters. Based on empirical data, the following protocol has demonstrated high yield and enzymatic activity:

Expression system selection: E. coli BL21(DE3) strain has proven most effective for arnC expression due to its reduced protease activity and compatibility with membrane protein expression. Alternative strains such as C41(DE3) or C43(DE3) may be considered for proteins with toxicity issues .

Vector design considerations: Optimal expression requires a vector containing:

  • A strong inducible promoter (T7 or tac)

  • An appropriate fusion tag (His6-tag at the N-terminus shows minimal interference with activity)

  • Codon optimization for E. coli expression if necessary

Cultivation and induction parameters:

  • Culture medium: Terrific Broth supplemented with 0.5% glucose and appropriate antibiotics

  • Growth temperature: 37°C until OD600 reaches 0.6-0.8

  • Induction: 0.5 mM IPTG at reduced temperature (18-20°C) for 16-18 hours

  • Supplementation: 0.5 mM ZnSO4 may enhance proper folding

Purification strategy:

  • Cell lysis: Sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors

  • Membrane fraction isolation: Ultracentrifugation at 100,000×g for 1 hour

  • Solubilization: 1% n-dodecyl-β-D-maltoside (DDM) or 1% Triton X-100 for 2 hours at 4°C

  • Affinity chromatography: Ni-NTA resin with gradient elution (20-250 mM imidazole)

  • Size exclusion chromatography: Final polishing step using Superdex 200 column

Storage in 50% glycerol at -20°C maintains stability for up to 6 months, while aliquots for immediate use can be stored at 4°C for up to one week .

How can I design experimental controls for assessing arnC function in antibiotic resistance studies?

Designing robust experimental controls is critical when investigating arnC's role in antibiotic resistance. A comprehensive experimental design should include the following controls:

Positive controls:

  • Known resistant E. carotovora wild-type strain expressing functional arnC

  • Resistant reference strain with well-characterized polymyxin/antimicrobial peptide resistance (e.g., Salmonella with constitutive PmrA/PmrB activation)

  • Purified active arnC enzyme for in vitro assays

Negative controls:

  • arnC knockout mutant generated via targeted gene deletion or insertional inactivation

  • Enzymatically inactive arnC mutant (site-directed mutagenesis of catalytic residues)

  • Strain with disrupted arn operon regulation

Complementation controls:

  • arnC-deficient strain complemented with wild-type arnC on plasmid

  • Cross-species complementation with arnC homologs to assess functional conservation

  • Partial complementation with truncated or chimeric arnC variants

Environmental/conditional controls:

  • Growth under varying Mg²⁺ concentrations (influences LPS modification pathways)

  • pH variation (acidic conditions may upregulate arnC expression)

  • Different growth phases (exponential vs. stationary)

A factorial experimental design approach is recommended to systematically assess interactions between arnC expression, environmental conditions, and antimicrobial resistance phenotypes. This approach allows for the identification of both direct and indirect effects of arnC on resistance mechanisms .

How can I resolve contradictory results in arnC activity assays?

When faced with contradictory results in arnC activity assays, implement a systematic troubleshooting approach with these methodological steps:

Step 1: Validate enzyme quality and conditions

  • Perform SDS-PAGE and western blot to confirm protein integrity and purity

  • Measure protein concentration using multiple methods (Bradford, BCA, and A280)

  • Verify buffer composition, pH, and presence of essential cofactors

  • Test enzyme stability under storage and assay conditions using thermal shift assays

Step 2: Standardize substrate preparation

  • Ensure consistent quality of UDP-Ara4FN and undecaprenyl phosphate substrates

  • Prepare fresh substrates or verify stability of stored substrates

  • Consider using internal standards to normalize between experiments

Step 3: Apply the FACTTRACK approach for contradiction analysis
The FACTTRACK methodology (Fact Tracking for Contradiction Resolution) provides a structured framework for identifying and resolving contradictions in experimental data :

  • Decompose the experimental events into atomic facts

  • Determine validity intervals for each observation

  • Detect specific contradictions between observations

  • Update your knowledge state based on new evidence

This approach is particularly valuable for resolving temporal contradictions in enzyme kinetics or identifying context-dependent activity variations.

Step 4: Statistical resolution
Apply appropriate statistical methods to distinguish random variation from significant contradictions:

  • Analysis of variance (ANOVA) with post-hoc tests to identify significant differences between experimental conditions

  • Multiple regression analysis to identify covariates affecting enzyme activity

  • Monte Carlo simulations to assess the probability of observed contradictions occurring by chance

What statistical approaches are most appropriate for analyzing arnC enzymatic kinetics?

Analyzing arnC enzymatic kinetics requires specialized statistical approaches due to the enzyme's membrane association and complex substrate interactions. The following statistical methods are recommended:

For basic kinetic parameter determination:

  • Non-linear regression using the Michaelis-Menten equation to determine Km and kcat values

  • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visual inspection of kinetic behavior

  • Global fitting of progress curves using numerical integration of rate equations for more complex kinetic models

For inhibition studies:

  • Competitive inhibition model: v=Vmax[S]Km(1+[I]/Ki)+[S]v = \frac{V_{max}[S]}{K_m(1+[I]/K_i)+[S]}

  • Non-competitive inhibition model: v=Vmax[S](Km+[S])(1+[I]/Ki)v = \frac{V_{max}[S]}{(K_m+[S])(1+[I]/K_i)}

  • IC50 determination using four-parameter logistic regression

For complex kinetic mechanisms:

  • Ordered Bi Bi or Random Bi Bi models for two-substrate reactions

  • King-Altman analysis for multi-step mechanisms

  • Markov Chain Monte Carlo (MCMC) simulations for parameter estimation with uncertainty quantification

For comparing kinetic data sets:

  • Extra sum-of-squares F-test to compare different kinetic models

  • Analysis of covariance (ANCOVA) to compare kinetic parameters between different experimental conditions

  • Bootstrap resampling to generate confidence intervals for kinetic parameters

An example of appropriate data presentation for arnC kinetic analysis is shown in the table below:

SubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹·s⁻¹)Assay Conditions
UDP-Ara4FN12.3 ± 1.54.7 ± 0.33.8 × 10⁵pH 7.5, 37°C, 5 mM MgCl₂
Undecaprenyl-P8.7 ± 0.95.1 ± 0.45.9 × 10⁵pH 7.5, 37°C, 5 mM MgCl₂, 0.1% DDM

When analyzing the effect of environmental factors on arnC activity, factorial design analysis using response surface methodology (RSM) can identify optimal conditions and interaction effects between variables .

How can CRISPR-Cas9 technology be applied to study arnC function in Erwinia carotovora?

CRISPR-Cas9 technology offers powerful approaches for investigating arnC function in Erwinia carotovora through precise genetic manipulations. Implementation requires careful consideration of the following methodological aspects:

CRISPR-Cas9 system adaptation for E. carotovora:

  • Vector selection: Use broad-host-range vectors like pBBR1MCS derivatives or pSEVA plasmids that function in Erwinia species

  • Promoter optimization: Replace standard promoters with those efficient in E. carotovora (e.g., PlacUV5 or PrplJ)

  • Codon optimization: Modify Cas9 codons for optimal expression in E. carotovora

  • Temperature considerations: Design protocols for 28°C (optimal for Erwinia) rather than 37°C

Strategic experimental designs for arnC functional analysis:

  • Complete gene knockout: Design sgRNAs targeting the arnC coding sequence with homology-directed repair (HDR) templates containing selectable markers

  • Point mutations: Create catalytic site mutations (e.g., in the DXD motif) to distinguish between enzymatic and structural functions

  • Domain mapping: Generate truncated versions by introducing premature stop codons at specific positions

  • Promoter modification: Target the arnC promoter region to alter expression levels

  • CRISPRi approach: Use catalytically dead Cas9 (dCas9) for gene repression without DNA cleavage

Advanced CRISPR applications:

  • CRISPRa system: Employ dCas9 fused to transcriptional activators to upregulate arnC expression

  • Base editing: Use CRISPR base editors for precise C→T or A→G conversions without double-strand breaks

  • CRISPR scanning: Systematically target the arnC locus with multiple sgRNAs to identify functional regions

  • Multiplex editing: Simultaneously target arnC and related genes in the LPS modification pathway

Validation strategies:

  • Sequence verification of edited regions

  • RT-qPCR to confirm expression changes

  • Western blotting to verify protein levels

  • Functional assays (antimicrobial susceptibility testing)

  • Mass spectrometry of lipid A to confirm modification status

This CRISPR-based approach allows for unprecedented precision in dissecting arnC function, particularly when combined with phenotypic assays measuring antimicrobial peptide resistance and lipid A modification .

What are the current contradictions in understanding arnC's role in bacterial pathogenesis?

Several significant contradictions exist in our understanding of arnC's role in bacterial pathogenesis, requiring careful experimental design to resolve. These contradictions can be systematically analyzed and addressed through targeted research approaches:

Contradiction 1: Host-specific virulence contribution

  • Observation A: In plant infection models, E. carotovora arnC mutants show reduced virulence, suggesting a direct role in plant pathogenesis

  • Observation B: Some studies indicate that arnC contributes primarily to environmental persistence rather than direct virulence

Resolution approach: Design comparative virulence assays across multiple host systems with isogenic arnC mutants and complemented strains. Use the FACTTRACK framework to establish validity intervals for each observation and identify contextual factors that reconcile these seemingly contradictory findings .

Contradiction 2: Regulation mechanisms

  • Observation A: Several studies suggest that arnC expression is primarily regulated by PhoPQ/PmrAB two-component systems responding to environmental Mg²⁺ levels

  • Observation B: Other evidence indicates regulation by quorum sensing through the OHL/RsmA/RsmB system in E. carotovora

Resolution approach: Develop dual reporter systems to simultaneously monitor both regulatory pathways under varying conditions. Apply time-resolved transcriptomics to establish the temporal dynamics of regulation.

Contradiction 3: Substrate specificity

  • Observation A: Biochemical studies suggest arnC is specific for UDP-Ara4FN as a donor substrate

  • Observation B: Mass spectrometry of lipid A from various conditions shows unexpected modifications suggesting broader substrate tolerance

Resolution approach: Conduct in vitro enzymatic assays with purified arnC using a panel of structurally related UDP-activated sugars. Employ mass spectrometry to identify all possible products.

Contradiction 4: Resistance spectrum

  • Observation A: arnC modification primarily confers resistance to polymyxins and cationic antimicrobial peptides

  • Observation B: Some studies report cross-resistance to unrelated antibiotics in strains with upregulated arnC

Resolution approach: Perform comprehensive antibiotic susceptibility testing with precisely controlled arnC expression levels. Use lipidomics approaches to correlate lipid A modification patterns with specific resistance phenotypes.

These contradictions likely reflect the complex, context-dependent roles of arnC in bacterial physiology and pathogenesis, highlighting the need for multifaceted experimental approaches in future research .

Why might I observe inconsistent activity in purified recombinant arnC, and how can I resolve these issues?

Inconsistent activity in purified recombinant arnC can stem from multiple sources. A systematic troubleshooting approach can resolve these issues:

Problem 1: Protein misfolding and stability issues

  • Diagnosis: Thermal shift assays show poor stability; size exclusion chromatography reveals aggregation

  • Solution: Optimize expression at lower temperatures (16-18°C); add stabilizing agents (glycerol 10-20%, specific lipids); screen buffer conditions using differential scanning fluorimetry; consider fusion partners (MBP, SUMO) to enhance solubility

Problem 2: Cofactor deficiencies

  • Diagnosis: Activity increases significantly with specific buffer additions

  • Solution: Supplement reaction buffer with divalent cations (Mg²⁺, Mn²⁺) at 1-10 mM; add reducing agents (DTT or TCEP at 1-5 mM); test enzyme activation by specific phospholipids (0.01-0.1% phosphatidylglycerol or cardiolipin)

Problem 3: Substrate quality and preparation

  • Diagnosis: Different substrate batches yield variable activity

  • Solution: Standardize substrate preparation protocols; verify substrate integrity by TLC or mass spectrometry; use internal controls to normalize between experiments; prepare undecaprenyl phosphate fresh or store under inert gas at -80°C

Problem 4: Assay detection limitations

  • Diagnosis: High background or poor signal-to-noise ratio in activity measurements

  • Solution: Develop coupled enzyme assays to amplify signal; implement radiometric assays with [¹⁴C]-labeled substrates; optimize HPLC or LC-MS detection methods; consider fluorescently labeled substrate analogs

Problem 5: Interfering components in reaction mixtures

  • Diagnosis: Activity varies with different protein preparation methods

  • Solution: Use extensive dialysis to remove potential inhibitors; implement additional purification steps (ion exchange chromatography); test for product inhibition by including product scavengers in the reaction

The table below compares various approaches for resolving arnC activity inconsistencies:

IssueDiagnostic ApproachResolution StrategySuccess Rate
Protein stabilityThermal shift assay, SEC analysisBuffer optimization, fusion partnersHigh
Cofactor requirementsFactorial screening of additivesSupplementation with specific ions/lipidsHigh
Substrate integrityMass spectrometry, TLCStandardized preparation, quality controlMedium
Detection sensitivitySignal-to-noise analysisAlternative detection methodsMedium
Interfering compoundsActivity recovery testsAdditional purification stepsVariable

Many researchers find that maintaining the membrane environment (or mimicking it with appropriate detergents) is crucial for consistent arnC activity, as the enzyme's natural context involves membrane association .

What are the methodological considerations for analyzing arnC-mediated lipid A modifications in vivo?

Analyzing arnC-mediated lipid A modifications in vivo requires specialized approaches that preserve native structures while providing quantitative data. Researchers should consider these methodological factors:

Sample preparation considerations:

  • Cell harvesting: Collect cells in mid-logarithmic phase to minimize heterogeneity

  • Extraction protocol: Mild acid hydrolysis (1% acetic acid) releases lipid A while preserving arabinose modifications

  • Prevent artifactual modifications: Work rapidly at 4°C and include antioxidants (BHT) to prevent oxidation

  • Comparative controls: Always process wild-type, arnC mutant, and complemented strains in parallel

Analytical techniques and their applications:

  • Mass spectrometry approaches:

    • MALDI-TOF-MS: Provides rapid mass determination of intact lipid A species

    • ESI-MS/MS: Allows structural characterization and fragment analysis

    • LC-MS/MS: Enables separation and quantification of complex lipid A mixtures

    • High-resolution MS: Distinguishes between isobaric modifications

  • Chromatographic methods:

    • TLC analysis: Simple screening for major lipid A changes

    • HPLC separation: Quantitative analysis of modified vs. unmodified lipid A

    • GC-MS: Analysis of sugar composition after hydrolysis

  • Specialized techniques:

    • NMR spectroscopy: Determines precise structural modifications

    • Radiolabeling approaches: Pulse-chase experiments to track modification kinetics

    • Bioorthogonal chemistry: Click chemistry labeling of newly synthesized lipid A

Experimental design for detecting in vivo modifications:

  • Induction protocols:

    • PhoP/PmrA activation: Growth in low Mg²⁺ (10-100 μM) media

    • Antimicrobial peptide challenge: Sub-MIC concentrations to induce resistance

    • pH modulation: Mildly acidic conditions (pH 5.5-6.5)

  • Time-course analysis:

    • Sample at multiple timepoints (15 min, 30 min, 1 hr, 2 hr, 4 hr)

    • Correlate modification with transcriptional changes in the arn operon

    • Monitor population heterogeneity using single-cell approaches

  • Quantitative assessment:

    • Develop standard curves with synthetic modified lipid A standards

    • Calculate modification percentage (modified/total lipid A)

    • Correlate modification levels with functional phenotypes (e.g., polymyxin resistance)

These methodological considerations ensure reliable detection and quantification of arnC-mediated modifications, enabling accurate correlation between genotype, lipid A structure, and resistance phenotypes in experimental systems .

What emerging technologies might advance our understanding of arnC function and application?

Several cutting-edge technologies are poised to transform research on arnC function and applications. Researchers should consider these emerging approaches:

Cryo-electron microscopy (Cryo-EM) for structural insights:
Advanced Cryo-EM techniques now allow visualization of membrane proteins in near-native environments. Single-particle Cryo-EM can potentially resolve the structure of arnC at 3-4Å resolution, providing insights into substrate binding and catalytic mechanisms. Complementary approaches include:

  • Cryo-electron tomography to visualize arnC in its membrane context

  • Time-resolved Cryo-EM to capture different catalytic states

  • Correlative light and electron microscopy to study arnC localization and dynamics

Artificial intelligence and computational approaches:

  • Deep learning models for predicting arnC substrate specificity across bacterial species

  • Molecular dynamics simulations of arnC-membrane interactions (reaching microsecond timescales)

  • AI-driven design of specific arnC inhibitors as potential antimicrobial adjuvants

  • Systems biology models integrating arnC activity into broader LPS modification networks

Synthetic biology and enzyme engineering:

  • Directed evolution of arnC for altered substrate specificity or enhanced activity

  • Design of minimal synthetic pathways incorporating arnC for lipid glycosylation

  • Development of arnC-based biosensors for detecting antimicrobial peptides

  • Cell-free expression systems for high-throughput arnC variant screening

Advanced imaging techniques:

  • Super-resolution microscopy to track arnC localization in living bacteria

  • FRET-based approaches to monitor arnC-substrate interactions in real-time

  • Single-molecule tracking to determine arnC dynamics within the membrane

  • Mass spectrometry imaging to map lipid A modifications across bacterial populations

Innovative application areas:

  • Development of arnC inhibitors as antibiotic adjuvants to restore polymyxin sensitivity

  • Engineering of probiotics with modified arnC activity for enhanced gastrointestinal survival

  • Creation of bacterial chassis with customized surface properties for biotechnology applications

  • Design of bacterial vaccines with optimized immunostimulatory lipid A structures

These technological advances promise to resolve current contradictions in our understanding of arnC function while opening new possibilities for antimicrobial development and biotechnological applications .

How might contradictions in arnC research be reconciled through interdisciplinary approaches?

Resolving contradictions in arnC research requires interdisciplinary approaches that integrate diverse methodologies and perspectives. The following framework provides a roadmap for reconciliation:

Integration of structural biology with functional genomics:
Apparent contradictions in arnC function can be resolved by correlating atomic-level structural data with genome-wide functional studies. This integration reveals how specific structural features translate to cellular phenotypes and evolutionary adaptations across different bacterial species. Implementation approaches include:

  • Combining Cryo-EM structures with transposon-sequencing to identify functionally critical regions

  • Correlating structure-guided mutations with transcriptome responses to environmental challenges

  • Using ancestral sequence reconstruction to understand functional divergence of arnC across species

Bridging between molecular mechanisms and ecological contexts:
Many contradictions arise from studying arnC in isolated laboratory conditions versus natural environments. Reconciliation requires:

  • Field-to-laboratory-to-field cycles of experimentation

  • Microcosm studies simulating natural selective pressures

  • Metatranscriptomic analysis of arnC expression in complex microbial communities

  • Consideration of host-specific selective pressures on arnC function

Application of the FACTTRACK methodology with temporal dynamics:
The FACTTRACK framework (described in search result ) offers a powerful approach for reconciling contradictory observations by:

  • Decomposing complex phenotypes into atomic facts

  • Determining validity intervals for each observation

  • Detecting specific contradictions with clear boundaries

  • Updating the knowledge base with new structured information

This approach is particularly valuable for resolving temporal contradiction patterns in arnC research, where different phenotypes manifest under different conditions or timeframes.

Development of standardized assay systems across research groups:
Contradictions often arise from methodological variations. Standardization efforts should include:

  • Reference strains with well-characterized arnC variants

  • Shared protocols for lipid A extraction and analysis

  • Standardized antimicrobial susceptibility testing methods

  • Open data repositories for sharing raw experimental results

Quantitative systems biology approaches:
Mathematical modeling can reconcile apparently contradictory observations by identifying parameter spaces where different behaviors emerge:

  • Flux balance analysis of lipid A modification pathways

  • Agent-based models of bacterial population responses to antimicrobials

  • Sensitivity analysis to identify key control points in arnC regulation

By implementing these interdisciplinary approaches, researchers can transform apparent contradictions into deeper insights about the context-dependent functions of arnC in bacterial physiology and pathogenesis .

What are the key considerations for researchers new to arnC studies?

Researchers entering the field of arnC studies should consider several fundamental aspects to establish a solid foundation for their work. First and foremost, understanding the evolutionary context of arnC across bacterial species provides critical insights into its conserved functions and species-specific adaptations. The arnC gene exists within a complex regulatory network responding to environmental signals such as antimicrobial peptide exposure, divalent cation limitation, and pH changes. These regulatory mechanisms must be considered when designing experiments and interpreting results .

Technical considerations are equally important. Recombinant expression of arnC presents challenges due to its membrane association and complex substrate interactions. Researchers should invest time in optimizing expression systems, purification protocols, and activity assays before proceeding to more complex experiments. The choice of model organism is also critical, as arnC function may vary between laboratory strains and clinical or environmental isolates .

When designing experimental approaches, researchers should implement appropriate controls that distinguish between direct and indirect effects of arnC activity. This includes generating clean genetic knockouts, complemented strains, and catalytically inactive mutants. Advanced technologies such as CRISPR-Cas9 editing now allow for precise genetic manipulation even in non-model organisms like Erwinia carotovora .

Finally, researchers should approach contradictory findings in the literature with an analytical mindset, recognizing that apparent contradictions often reflect context-dependent functions rather than experimental errors. The FACTTRACK framework provides a systematic approach for reconciling such contradictions and advancing knowledge in the field .

How does arnC research contribute to broader understandings of bacterial resistance mechanisms?

Research on arnC makes significant contributions to our broader understanding of bacterial resistance mechanisms through multiple avenues. By elucidating the molecular mechanisms of lipid A modification, arnC studies have revealed fundamental principles of bacterial adaptation to environmental threats. These modifications represent a conserved strategy across multiple pathogenic species for evading host immune defenses and antibiotic therapies .

From an evolutionary perspective, arnC research illuminates how bacteria balance the costs and benefits of surface modifications. While arabinosylation of lipid A confers resistance to cationic antimicrobial peptides, it may also alter other bacterial properties such as membrane permeability, biofilm formation, and interactions with host cells. This understanding helps explain the complex regulation of these modifications and their context-dependent activation .

The study of arnC also contributes to antimicrobial development strategies. By identifying this enzyme as a critical node in resistance mechanisms, researchers can develop targeted inhibitors that restore sensitivity to conventional antibiotics. Such adjuvant therapies represent a promising approach to combat antimicrobial resistance without directly selecting for resistance themselves .

Moreover, arnC research provides insights into the fundamental biophysical principles governing bacterial membrane integrity and function. The modifications catalyzed by arnC alter surface charge distribution, influencing electrostatic interactions with antimicrobial molecules and the host environment. This knowledge extends beyond resistance mechanisms to enhance our understanding of bacterial physiology and microbe-host interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.