Recombinant Erwinia carotovora subsp. atroseptica Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uspB; ECA0049; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
uspB
Target Protein Sequence
MISTFALFWALCIVCIINMARYYSSLRVLLMILRDCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIYAQRYLDHHDPEFIRRCERVRGQFLLTTALCGLIVISLIAMMMWY
Uniprot No.

Target Background

Database Links

KEGG: eca:ECA0049

STRING: 218491.ECA0049

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal Stress Protein B (uspB) and what is its role in Erwinia carotovora subsp. atroseptica?

Universal Stress Protein B (uspB) belongs to the universal stress protein (Usp) family, which is highly conserved across bacteria, archaea, plants, and some invertebrate animals. These proteins typically serve regulatory and protective roles that enable adaptation and survival under external stresses . In Erwinia carotovora subsp. atroseptica, uspB likely functions as part of the stress response network that helps the bacterium adapt to changing environments during its lifecycle as both a plant pathogen and during transit through insect vectors. While the specific functions of uspB in E. carotovora are still being elucidated, it likely contributes to the bacterium's ability to survive environmental stresses encountered during host infection and transmission.

To study uspB function, researchers should consider:

  • Generating knockout mutants using homologous recombination techniques

  • Performing complementation studies with the wild-type gene

  • Conducting phenotypic analyses under various stress conditions (pH, temperature, oxidative stress)

  • Examining gene expression patterns using qRT-PCR during different growth phases and stress conditions

How can researchers best isolate and purify recombinant uspB from E. carotovora subsp. atroseptica?

Isolation and purification of recombinant uspB requires careful optimization of expression systems and purification protocols. The following methodological approach is recommended:

Expression system selection:

  • Choose between E. coli-based expression (BL21(DE3) or similar strains) or homologous expression in Erwinia

  • Clone the uspB gene with an appropriate affinity tag (His6, GST, or MBP) to facilitate purification

  • Optimize codon usage if expressing in E. coli to account for codon bias differences

Expression conditions:

  • Test multiple induction conditions (temperature, inducer concentration, duration)

  • Monitor protein solubility under different conditions

  • Consider using specialized media formulations to enhance protein yield

Purification protocol:

  • Lyse cells using mechanical disruption (sonication or French press)

  • Clarify lysate by centrifugation (16,000 × g, 30 min, 4°C)

  • Perform affinity chromatography using the appropriate resin

  • Include secondary purification steps (ion exchange, size exclusion)

  • Verify purity using SDS-PAGE and Western blot analysis

Researchers should be aware that uspB may form inclusion bodies under certain expression conditions, necessitating refolding protocols if high yields are required.

How does uspB expression change under different stress conditions in E. carotovora subsp. atroseptica?

Universal stress proteins typically show dynamic expression patterns in response to various environmental stressors. For uspB in E. carotovora subsp. atroseptica, expression profiles likely vary across different conditions:

Stress ConditionRelative uspB ExpressionTechniques for MeasurementNotes
Nutrient limitationHighqRT-PCR, RNA-SeqMay be regulated through RelA/SpoT (stringent response) pathways
Oxidative stressModerate-HighReporter fusion assaysExpression timeline may differ from other USPs
Temperature shockVariableNorthern blotting, qRT-PCRCold shock may induce differently than heat shock
Acidic pHModerateRNA-Seq, microarrayImportant during plant infection process
Plant extract exposureHighqRT-PCR, proteomicsMay coordinate with virulence factor expression
Quorum sensing activationHighReporter fusions, qRT-PCRLikely responds to N-(3-oxohexanoyl)-L-homoserine lactone

To systematically study uspB expression, researchers should:

  • Generate transcriptional and translational reporter fusions (uspB-lacZ, uspB-gfp)

  • Monitor expression under controlled stress conditions

  • Compare expression patterns with other stress-responsive genes

  • Correlate expression with physiological changes in the bacterium

The regulation may involve integration with other stress response systems, including the RsmA/rsmB system which controls virulence factor production in E. carotovora .

What experimental design considerations are most important when studying uspB function?

When designing experiments to study uspB function in E. carotovora subsp. atroseptica, researchers should consider several key experimental design principles:

Replication and controls:

  • Include biological replicates (minimum n=3) for all experiments

  • Incorporate appropriate positive and negative controls

  • Include wild-type, uspB mutant, and complemented strains in all assays

Power analysis:

  • Conduct a priori power analysis to determine adequate sample sizes

  • Ensure sufficient statistical power to detect biologically relevant effects

  • Consider variability in bacterial growth and stress responses when calculating required replication

Phenotypic assays:

  • Measure multiple phenotypic outputs (growth rates, stress survival, virulence)

  • Use standardized methods for stress exposure (duration, intensity)

  • Implement appropriate data normalization strategies

Gene expression studies:

  • Select stable reference genes for qRT-PCR normalization

  • Use time-course designs to capture dynamic expression changes

  • Consider the effects of growth phase on expression patterns

Avoiding questionable research practices:

  • Pre-register experimental designs where possible

  • Report all tested conditions, not just those showing significant effects

  • Follow open research practices to increase transparency and reproducibility

Researchers should be aware that, like other USP family members, uspB knockout may not always produce a distinct phenotype due to potential functional redundancy with other stress response proteins .

How is uspB regulated in E. carotovora subsp. atroseptica?

The regulation of uspB in E. carotovora subsp. atroseptica likely involves multiple regulatory systems that integrate environmental signals:

Quorum sensing regulation:
Evidence suggests that universal stress proteins in E. carotovora are regulated by quorum sensing systems using N-(3-oxohexanoyl)-L-homoserine lactone (HSL) as a signaling molecule . This regulation connects population density sensing with stress response mechanisms. Researchers studying this aspect should:

  • Monitor uspB expression in quorum sensing mutants (expI mutants)

  • Test the effects of exogenous HSL addition on uspB expression

  • Examine the uspB promoter region for potential binding sites for quorum sensing regulators

Two-component systems:
The GacS/A two-component system has been shown to regulate stress responses and virulence factors in E. carotovora . This system likely influences uspB expression as well. Experimental approaches should include:

  • Analysis of uspB expression in gacA and gacS mutant backgrounds

  • Chromatin immunoprecipitation to identify direct regulatory interactions

  • Epistasis analysis between GacS/A system components and uspB

RsmA/rsmB system:
The RsmA/rsmB regulatory system controls virulence factor production in E. carotovora, with RsmC serving as an additional regulator . This post-transcriptional regulation system may control uspB expression. Researchers should:

  • Examine uspB expression in rsmA, rsmB, and rsmC mutants

  • Test for direct binding between RsmA protein and uspB mRNA

  • Evaluate uspB translation efficiency in different regulatory backgrounds

Understanding the complex regulatory networks controlling uspB will require integrated approaches combining genetics, molecular biology, and systems biology.

How does uspB interact with other stress response systems in E. carotovora during host adaptation?

The interaction between uspB and other stress response systems represents a complex, multilayered regulatory network that enables E. carotovora to adapt to different host environments:

Integration with quorum sensing and two-component systems:
Universal stress proteins like uspB likely function as part of an integrated stress response network coordinated with quorum sensing and two-component signaling systems . E. carotovora uses different sets of virulence factors for plant infection (cell wall-degrading enzymes) versus insect infection (Erwinia virulence factor, evf), but both are coactivated by homoserine lactone quorum sensing and the GacS/A system . Researchers investigating these interactions should:

  • Generate multiple deletion mutants (uspB combined with quorum sensing or two-component system components)

  • Perform epistasis analysis to determine hierarchical relationships

  • Use protein-protein interaction studies (bacterial two-hybrid, co-immunoprecipitation) to identify direct interactions

  • Conduct transcriptome and proteome analysis of single and multiple mutants

Relationship with stringent response:
Universal stress proteins have been associated with the stringent response mediated by spoT and relA . For uspB specifically, researchers should:

  • Measure (p)ppGpp levels in uspB mutants under stress conditions

  • Examine uspB expression in relA and spoT mutant backgrounds

  • Test for synergistic phenotypes in double mutants

  • Evaluate the presence of potential (p)ppGpp binding sites in uspB protein

Connection to virulence regulation:
The potential role of uspB in coordinating stress responses with virulence factor production should be investigated through:

  • Virulence assays comparing wild-type and uspB mutants in plant infection models

  • Analysis of cell wall-degrading enzyme production in uspB mutants

  • Evaluation of the uspB mutant's ability to colonize and transmit through insect vectors

  • Characterization of uspB expression during different stages of the infection cycle

Understanding these complex interactions will require systems biology approaches to map the regulatory networks involved.

What structural and functional differences exist between uspB and other USP family proteins in E. carotovora?

Understanding the structural and functional differentiation between uspB and other USP family members is crucial for determining their specialized roles:

Structural comparisons:
USP family proteins typically share a conserved domain structure but may have distinctive features that determine their specific functions:

USP Family MemberDomain ArchitecturePredicted Structural FeaturesPotential Functional Implications
uspASingle USP domainATP-binding motif presentLikely involved in ATP-dependent signaling
uspBSingle USP domainModified ATP-binding siteMay function in an ATP-independent manner
uspCTandem USP domainsDimerization interfacePotential scaffold for protein complexes
uspDUSP domain with accessory domainsAdditional enzymatic motifsMay have dual regulatory/enzymatic function
uspETandem USP domainsExtended C-terminal regionPossible membrane association

Methodological approaches for structural studies should include:

  • Protein crystallography or cryo-EM for high-resolution structure determination

  • Homology modeling based on solved USP structures from other organisms

  • Molecular dynamics simulations to predict functional motions

  • Site-directed mutagenesis of predicted functional residues followed by activity assays

Functional differentiation:
To determine the functional specialization of uspB compared to other USPs:

  • Generate a panel of single and multiple USP gene knockouts

  • Conduct phenotype microarrays to identify condition-specific roles

  • Perform transcriptomics and proteomics on different USP mutants under various stresses

  • Use ChIP-seq or similar approaches to identify potential DNA-binding activities

Evolutionary analysis:
Comparative genomics approaches can provide insights into the evolutionary history and potential functional divergence:

  • Phylogenetic analysis of USP proteins across multiple Erwinia species

  • Synteny analysis to identify conserved genomic contexts

  • Selection pressure analysis to identify residues under positive selection

  • Comparative analysis of USP repertoires across pathogenic and non-pathogenic strains

These approaches will help delineate the specialized functions of uspB versus other USP family members in E. carotovora.

How can knockout or knockdown experiments for uspB be designed to study its role in virulence?

Designing effective knockout and knockdown experiments for uspB requires careful consideration of genetic tools, phenotypic assays, and potential compensatory mechanisms:

Generation of uspB mutants:

  • Homologous recombination approach:

    • Design primers to amplify 500-1000 bp regions flanking the uspB gene

    • Clone these regions into a suicide vector with an antibiotic resistance marker

    • Transform E. carotovora with the construct and select for double recombination events

    • Verify deletion by PCR and sequencing

  • CRISPR-Cas9 approach:

    • Design sgRNAs targeting the uspB coding sequence

    • Clone into a CRISPR-Cas9 vector adapted for E. carotovora

    • Transform and select for edited clones

    • Confirm edits by sequencing and expression analysis

  • Controllable knockdown systems:

    • Develop an antisense RNA or CRISPRi system for E. carotovora

    • Create constructs with inducible promoters controlling knockdown elements

    • Validate knockdown efficiency using qRT-PCR and Western blotting

    • Titrate expression levels to examine dose-dependent effects

Virulence phenotype analysis:

Assay TypeMethodologyParameters to MeasureControls Required
Plant infectionPotato tuber/leaf infiltrationTissue maceration area, bacterial populationWild-type, complemented mutant
Enzyme productionSpectrophotometric assaysPectate lyase, cellulase, protease activitiesKnown enzyme production mutants
Insect colonizationDrosophila oral infectionBacterial persistence, insect survivalAttenuated control strains
Gene expressionqRT-PCR arraysVirulence gene expression patternsReference genes validated for each condition
Stress survivalViability assaysSurvival under oxidative, acid, osmotic stressKnown stress-sensitive mutants

Complementation and rescue experiments:

  • Reintroduce wild-type uspB under native or inducible promoters

  • Create point mutants affecting predicted functional domains

  • Test heterologous complementation with USPs from related bacteria

  • Develop dual-reporter systems to monitor both uspB expression and virulence factor production

When interpreting results, researchers should be aware that, like other USP family members, uspB may have partially redundant functions with other stress response proteins, potentially masking phenotypes in single gene knockout experiments .

What methodological approaches can resolve contradictory data regarding uspB function in E. carotovora pathogenicity?

Contradictory findings regarding uspB function in pathogenicity are common in complex biological systems and require specific methodological approaches to resolve:

Standardization of experimental conditions:
Inconsistent results often stem from subtle differences in experimental conditions. Researchers should:

  • Develop standardized growth media and conditions specifically for uspB studies

  • Create detailed protocols for stress exposure and virulence assays

  • Establish reference strains that can be shared between laboratories

  • Define precise parameters for measuring infection outcomes

Multi-laboratory replication studies:

  • Coordinate parallel experiments across multiple laboratories

  • Use identical genetic constructs, media preparations, and protocols

  • Implement blinded analysis of results to reduce experimenter bias

  • Perform statistical meta-analysis of combined datasets

Integrated multi-omics approaches:
When functional data appears contradictory, multi-omics can provide a more comprehensive picture:

ApproachMethodologyContribution to Understanding
TranscriptomicsRNA-Seq under various conditionsIdentifies gene networks and compensatory responses
ProteomicsLC-MS/MS with quantitative labelingReveals post-transcriptional regulation effects
MetabolomicsGC-MS and LC-MS profilingDetects metabolic shifts indicative of functional roles
InteractomicsAP-MS, BioID, or crosslinking studiesMaps protein-protein interaction networks
Phenotypic microarraysBiolog or similar systemsIdentifies condition-specific requirements for uspB

Context-dependent function analysis:
USPs often show context-dependent functions that may explain contradictory results:

  • Test uspB function across different growth phases (exponential vs. stationary)

  • Examine uspB roles in different host environments (plant vs. insect)

  • Investigate potential functional redundancy with other stress response systems

  • Consider threshold effects where phenotypes only appear under specific stress intensities

Experimental design considerations:
Researchers should implement robust experimental design principles:

  • Conduct proper power analysis to ensure adequate sample sizes

  • Use appropriate statistical methods for the data structure

  • Implement randomization and blinding where possible

  • Report all experimental conditions transparently, including "failed" experiments

By combining these approaches, researchers can develop a more nuanced understanding of uspB function that accounts for seemingly contradictory observations.

How can advanced imaging techniques be applied to study uspB localization and dynamics during host infection?

Understanding the spatiotemporal dynamics of uspB during infection requires sophisticated imaging approaches tailored to bacterial-host interactions:

Fluorescent protein fusion techniques:

  • Generate C- and N-terminal fluorescent protein fusions to uspB

  • Validate functionality of fusion proteins through complementation assays

  • Create dual-color systems to simultaneously track uspB and other proteins

  • Use photoactivatable or photoswitchable fluorescent proteins for pulse-chase experiments

Advanced microscopy methods for live imaging:

TechniqueApplication for uspB ResearchAdvantagesLimitations
Confocal microscopyBasic localization in cultured cellsGood optical sectioning, widely availableLimited resolution (~200 nm)
Super-resolution (STORM/PALM)Nanoscale organization of uspB complexesAchieves 20-30 nm resolutionOften requires fixed samples
Light sheet microscopyImaging uspB dynamics in intact plant tissueLow phototoxicity, rapid 3D acquisitionComplex sample preparation
Single-molecule trackingFollowing individual uspB moleculesReveals heterogeneous behaviorsTechnically challenging in bacteria
FRET/FLIMDetecting uspB protein interactionsReports direct protein-protein contactsRequires careful controls

In vivo imaging during infection:
To study uspB during actual host interactions:

  • Develop microfluidic systems that mimic host environments while allowing imaging

  • Create transparent plant tissue models for direct visualization

  • Implement correlative light and electron microscopy (CLEM) to combine functional and ultrastructural information

  • Use biosensors coupled to uspB to report on local environmental conditions

Quantitative image analysis:
Advanced computational approaches are essential:

  • Develop automated tracking algorithms for uspB-labeled bacteria during infection

  • Implement machine learning for pattern recognition in complex tissues

  • Use mathematical modeling to interpret dynamic behaviors

  • Create standardized image analysis pipelines to ensure reproducibility

Experimental considerations:

  • Test multiple fluorescent protein variants to minimize artifacts

  • Include proper controls for autofluorescence, especially in plant tissues

  • Validate imaging findings with complementary biochemical approaches

  • Consider potential effects of the imaging conditions on bacterial physiology

These advanced imaging approaches can provide unprecedented insights into uspB function during the infection process, revealing spatial and temporal aspects of its role that cannot be captured by traditional biochemical or genetic methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.