Recombinant Erwinia carotovora subsp. atroseptica UPF0059 membrane protein ECA2389 (ECA2389)

Shipped with Ice Packs
In Stock

Description

Production and Purification

ECA2389 is produced recombinantly in E. coli using optimized protocols to address challenges in membrane protein solubility and stability . Key steps include:

  • Transcriptional Tuning: Use of strains like LEMO21(DE3) to regulate T7 RNA polymerase activity, balancing protein yield and membrane insertion efficiency .

  • Purification: Detergent-based solubilization followed by affinity chromatography (e.g., Ni-NTA for His-tagged variants) .

  • Reconstitution: Stabilization in Tris-glycerol buffers to maintain structural integrity .

Research Applications

ECA2389 is primarily utilized in:

  • ELISA Assays: Detecting antigen-antibody interactions in plant-pathogen studies .

  • Structural Biology: Serving as a model for studying prokaryotic membrane protein folding and stability .

  • Comparative Proteomics: Benchmarking expression systems for challenging membrane proteins .

Comparative Analysis with Related Proteins

FeatureECA2389 (UPF0059)ECA3803 (UPF0289)
Length187 residues250 residues
Expression HostE. coliE. coli
Functional AnnotationMembrane-associatedCell division (ZapD homolog)
ConservationBroad prokaryotic presenceSpecies-specific

Challenges and Future Directions

  • Functional Characterization: No enzymatic or transport activity has been experimentally validated for ECA2389.

  • Pathogenicity Link: Genome sequencing of E. carotovora subsp. atroseptica identifies unique virulence genes , but ECA2389’s role remains speculative.

  • Structural Studies: Cryo-EM or X-ray crystallography could resolve its 3D conformation and ligand-binding sites .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: Our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please contact us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; ECA2389; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
mntP
Target Protein Sequence
MNMSATLILAFAMSMDAFAASIGKGAVLHNPRFRDAIRTGLIFGVIEAITPLIGWALGFF ASQYILEWDHWVAFTLLLILGGRMVVEGFKDSPDCRCEKVKNHSLALLVCTAIATSLDAM AIGVGLAFLQVNIFHTAMVIGCATMIMVTLGMMIGRYIGPILGKKAEIIGGLVLIGIGCN ILYEHLG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: eca:ECA2389

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the general structure and composition of ECA2389 membrane protein?

While specific structural data for ECA2389 is limited, it belongs to the UPF0059 family of membrane proteins from Pectobacterium atrosepticum. Based on related membrane proteins from this organism, such as ECA1987, these proteins typically contain multiple transmembrane helices with both cytoplasmic and periplasmic domains. The amino acid sequence determines its hydrophobicity profile and membrane integration pattern, which can be analyzed using bioinformatics tools to predict transmembrane regions and topology .

What expression systems are most effective for producing recombinant ECA2389?

E. coli remains the preferred expression system for recombinant membrane proteins from Erwinia carotovora. The BL21-Gold (DE3) strain has shown particular effectiveness for related membrane proteins. When expressing ECA2389, it's recommended to use expression vectors with N-terminal His-tags for purification and detection purposes. The protein can be expressed as a full-length construct (similar to related proteins) in E. coli with appropriate vector systems such as pET-based vectors that provide strong, inducible expression .

How can I optimize codon usage for maximum expression of ECA2389 in E. coli?

Optimizing the N-terminal codons has shown significant impact on recombinant protein production. Rather than using a single predefined optimization strategy, a directed evolution approach using randomized N-terminal sequences followed by selection via fluorescence-activated cell sorting (FACS) has demonstrated up to 30-fold increases in protein yields. This approach involves creating DNA libraries coding for modified N-termini of the target protein, fusing them with GFP at the C-terminus, and selecting high-producing variants using FACS .

What strategies can overcome low expression yields of ECA2389?

For membrane proteins like ECA2389 that may show low expression, several approaches can be implemented:

  • N-terminal sequence optimization: Create libraries with randomized N-terminal sequences (6-9 amino acids) and select high-expressing variants using FACS with a C-terminal GFP fusion.

  • Expression vector optimization: Test both T7 promoter-based systems (like pET22b) and T5 promoter-based systems (like pQE30) to identify optimal expression conditions.

  • Temperature and induction optimization: Lower expression temperatures (18°C) with extended expression times often improve membrane protein folding and solubility.

  • Fusion partners: Addition of solubility-enhancing fusion partners like thioredoxin can improve expression yields.

The most effective approach appears to be the directed evolution method, which has demonstrated significant yield improvements for challenging proteins .

How can I engineer the ECA2389 construct to enhance membrane integration and proper folding?

Membrane integration and proper folding can be enhanced through strategic modifications:

  • Transmembrane domain optimization: Analyze the hydrophobicity profile of ECA2389 and modify hydrophobic residues if necessary to enhance membrane integration.

  • Leader sequence selection: Test different leader sequences that target the protein to the membrane.

  • Fusion with well-folded membrane proteins: Create chimeric constructs with well-characterized membrane proteins to improve folding.

  • Expression strain selection: Use specialized E. coli strains with enhanced membrane protein expression capability.

These approaches require systematic testing as the effectiveness may vary depending on the specific properties of ECA2389 .

What is the recommended purification protocol for His-tagged ECA2389?

Based on successful purification strategies for related Erwinia proteins, a multi-step purification protocol is recommended:

  • Cell lysis: Ultrasonic disintegration of biomass in a buffer containing 20-50 mM Tris-HCl (pH 8.0), 150-300 mM NaCl, and protease inhibitors.

  • Detergent solubilization: Solubilize membrane fractions using mild detergents like DDM (n-Dodecyl β-D-maltoside) at 1% concentration.

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with gradual imidazole elution (20-300 mM).

  • Secondary purification: Ion exchange chromatography on CM-Sepharose or SP-Sepharose.

  • Size exclusion chromatography: Final polishing step to remove aggregates and ensure homogeneity.

The purified protein should be stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

How can I assess the purity and integrity of purified ECA2389?

Purity and integrity assessment should include multiple complementary techniques:

  • SDS-PAGE: Use gradient gels (10-15%) to visualize protein purity with Coomassie staining; expect >90% purity for high-quality preparations.

  • Western blotting: Use anti-His antibodies to confirm the presence of the tagged protein.

  • Mass spectrometry: Confirm the protein identity and detect any post-translational modifications or degradation products.

  • Size exclusion chromatography: Assess the monodispersity of the protein preparation.

  • Circular dichroism: Evaluate the secondary structure integrity, particularly important for membrane proteins.

The protein should show a single band on SDS-PAGE with minimal degradation products or impurities .

What approaches are recommended for structural analysis of ECA2389?

Structural characterization of membrane proteins like ECA2389 requires specialized techniques:

  • Reconstitution in lipid nanodiscs: This approach maintains the protein in a native-like membrane environment, allowing for structural studies.

  • Cryo-electron microscopy: Particularly valuable for membrane proteins that may be difficult to crystallize.

  • X-ray crystallography: Requires obtaining well-diffracting crystals, which can be challenging but provides high-resolution data.

  • Computational modeling: Use homology modeling based on related structures alongside newer AI-based prediction tools like AlphaFold, noting that these predictions may diverge from experimental structures.

When analyzing the structure, look for characteristic features of membrane proteins such as transmembrane helices and folded cytosolic domains .

How can I determine the oligomeric state of ECA2389 in membranes?

Determining the oligomeric state requires multiple complementary approaches:

  • Crosslinking studies: Use bifunctional crosslinkers of various spacer lengths to trap oligomeric species.

  • Blue native PAGE: Allows separation of protein complexes under native conditions.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Provides accurate molecular weight determination of membrane protein-detergent complexes.

  • Analytical ultracentrifugation: Can determine the sedimentation coefficient and molecular weight of protein-detergent complexes.

  • Single-particle cryo-EM: Can directly visualize oligomeric assemblies in detergent micelles or lipid nanodiscs.

The stability of oligomers should be tested under various conditions, including different detergents and lipid compositions .

What methods are suitable for investigating the function of ECA2389?

As the specific function of ECA2389 is not well-characterized, multiple approaches should be employed:

  • Bioinformatic analysis: Compare sequence with characterized proteins to identify potential functional domains.

  • Gene knockout studies: Examine the phenotype of bacteria lacking the ECA2389 gene.

  • Protein-protein interaction studies: Use pull-down assays, two-hybrid systems, or proximity labeling to identify interaction partners.

  • Liposome reconstitution: Test for potential transport activity or channel function using fluorescent dyes or radioactive substrates.

  • Electrophysiology: If channel activity is suspected, patch-clamp analysis of reconstituted protein can provide functional insights.

These approaches should be used in combination to build a comprehensive understanding of ECA2389 function .

How can I investigate potential interactions between ECA2389 and other bacterial membrane components?

To investigate membrane protein interactions:

  • Co-immunoprecipitation: Use antibodies against the tagged ECA2389 to pull down interaction partners from solubilized membranes.

  • Chemical crosslinking followed by mass spectrometry: Identify proteins that are in close proximity to ECA2389 in the native membrane.

  • Bacterial two-hybrid system: Specifically designed for membrane protein interactions.

  • Fluorescence resonance energy transfer (FRET): Can detect interactions between fluorescently labeled membrane proteins.

  • Native mass spectrometry: Recently developed techniques allow analysis of intact membrane protein complexes.

When analyzing interactions, it's important to distinguish specific interactions from non-specific associations that may occur during solubilization .

What are the optimal storage conditions for purified ECA2389?

Based on information for related membrane proteins:

  • Storage temperature: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use.

  • Buffer composition: Use Tris/PBS-based buffer with 6% trehalose, pH 8.0.

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Cryoprotectant: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week.

Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and aggregation .

What controls should be included in expression and purification experiments with ECA2389?

A comprehensive set of controls should include:

Control TypePurposeImplementation
Negative expression controlValidate expression systemE. coli with empty vector
Positive expression controlBenchmark expression efficiencyWell-expressed membrane protein (e.g., GFP-tagged membrane protein)
Purification controlsMonitor non-specific bindingProcess uninduced culture or empty vector control
Functionality controlsVerify protein activityKnown functional assays for related proteins
Stability controlsMonitor degradationTime-course analysis of stored protein samples

These controls help distinguish between experimental artifacts and true biological effects, essential for reproducible results .

How can I troubleshoot low yields or poor solubility of ECA2389?

Systematic troubleshooting approaches include:

  • Expression optimization matrix:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Vary induction conditions (IPTG concentration: 0.1-1.0 mM)

    • Try different expression temperatures (18°C, 25°C, 30°C, 37°C)

    • Adjust expression duration (3 hours to overnight)

  • Solubilization screening:

    • Test multiple detergents (DDM, LMNG, OG, digitonin)

    • Vary detergent concentration (0.5-2%)

    • Test different solubilization times and temperatures

  • Buffer optimization:

    • Screen pH range (pH 6.0-9.0)

    • Test various salt concentrations (100-500 mM NaCl)

    • Add stabilizing additives (glycerol, sucrose, specific lipids)

  • Genetic modifications:

    • Create fusion constructs with solubility-enhancing partners

    • Test N-terminal sequence libraries as described in recent research

For membrane proteins like ECA2389, directed evolution of N-terminal sequences has shown particular promise in improving yields .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.