Recombinant Erwinia carotovora subsp. atroseptica UPF0208 membrane protein ECA3038 (ECA3038)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. To request a specific tag, please inform us; we will prioritize fulfilling such requests.
Synonyms
ECA3038; UPF0208 membrane protein ECA3038
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
ECA3038
Target Protein Sequence
MATKPDSRISWLQLLQRGQHYMKTWPAEKQLAPLFPENRVARATRFGIRIMPPLAVFTLT WQIALGGQLGPAIATALFACSLPLQGLWWLGRRSVTPLPPTLAQWFHEIRHKLLESGQAL APLEEAPTYQTLADVLKRAFNQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: eca:ECA3038

STRING: 218491.ECA3038

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Which expression systems are most suitable for recombinant ECA3038 production?

Multiple expression systems have been validated for successful recombinant ECA3038 production, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesRecommended Host StrainsNotes
E. coliRapid growth, high yield, cost-effectiveBL21(DE3), Rosetta-GAMIPreferred for structural studies
YeastPost-translational modifications, secretionSMD1168, GS115, X-33Better protein folding for complex proteins
Insect CellAdvanced eukaryotic PTMs, membrane protein expressionSf9, Sf21, High FiveHigher success rate for membrane proteins
MammalianNative-like glycosylation, complex folding293T, CHO, COS-7Recommended for functional studies
Cell-FreeRapid, avoids toxicity issuesN/AUseful for preliminary studies

When selecting an expression system, consider your downstream applications. E. coli systems typically yield ≥85% protein purity as determined by SDS-PAGE and are sufficient for many applications, while more complex studies may benefit from eukaryotic expression systems .

How should researchers optimize storage conditions for ECA3038?

For optimal stability and activity retention of recombinant ECA3038:

  • Store purified protein at -20°C for routine use, or at -80°C for extended storage periods

  • Use a Tris-based buffer containing 50% glycerol that has been specifically optimized for this membrane protein

  • Avoid repeated freeze-thaw cycles as they significantly decrease protein stability and activity

  • For working aliquots that will be used within one week, storage at 4°C is acceptable

  • Consider lyophilization for long-term storage if available, as this has been shown to preserve structure and function effectively

Stability assessments should be performed before and after storage using activity assays or structural integrity verification to ensure the protein maintains its native conformation.

What purification strategies yield highest purity and activity for ECA3038?

Purification of membrane proteins like ECA3038 requires specialized approaches to maintain native conformation:

  • Initial extraction: Use mild detergents (DDM, CHAPS, or digitonin) to solubilize the membrane protein while preserving structure

  • Affinity chromatography: Leverage fusion tags (His, FLAG, MBP) with optimized binding and elution conditions

  • Size exclusion chromatography: Remove aggregates and separate oligomeric states

  • Quality control: Verify purity using SDS-PAGE (target ≥85-95% purity)

For recombinant ECA3038, His-tag purification has demonstrated excellent results when combined with optimized buffer conditions. Researchers should monitor protein activity throughout purification steps to ensure functional integrity is maintained.

How do fusion tags affect ECA3038 structure and function?

Various fusion tags can be incorporated at either the N-terminal or C-terminal position of ECA3038, each with distinct effects:

TagSizeInfluence on ECA3038Recommended PositionCleavage Options
His Tag6-10 aaMinimal impact on structure, excellent for purificationN or C-terminalTEV protease
FLAG Tag8 aaLow interference, good for immunodetectionN-terminalEnterokinase
MBP40 kDaEnhances solubility, may affect membrane integrationN-terminalFactor Xa
GST26 kDaIncreases solubility, dimerizesN-terminalThrombin
GFP27 kDaAllows visualization, may impact membrane topologyC-terminalSUMO protease

When designing constructs, researchers should consider whether the tag will be removed post-purification, as tag position and presence can influence membrane insertion and protein folding . For structural studies, tag removal is often necessary, while for localization studies, C-terminal GFP fusions have proven particularly valuable.

What expression conditions maximize yield of functional ECA3038?

Based on related research with Erwinia carotovora proteins, optimized expression protocols can significantly improve yields. A fed-batch cultivation strategy has demonstrated exceptional results for recombinant protein production from this organism:

  • Media selection: Terrific Broth or semi-defined media outperform standard LB medium

  • Temperature: Induction at lower temperatures (25-30°C) improves proper folding of membrane proteins

  • Feeding strategy: DO-stat feeding with induction at approximately 18 hours of culture maximizes protein yield

  • IPTG concentration: 0.1-0.5 mM IPTG is typically optimal for balanced expression and proper folding

  • Harvest timing: Collection 4-6 hours post-induction for E. coli systems

Using optimized fed-batch techniques with similar Erwinia proteins has yielded up to 30.7 g of dry cell weight and 0.9 g of soluble recombinant protein per liter of culture . These protocols can be adapted for ECA3038 expression with appropriate modifications for membrane protein characteristics.

What analytical methods are most effective for characterizing ECA3038 structure and function?

For comprehensive characterization of recombinant ECA3038:

  • Structural analysis:

    • Circular dichroism spectroscopy for secondary structure assessment

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) for oligomeric state determination

    • Cryo-EM or X-ray crystallography for high-resolution structural determination (requires specialized membrane protein crystallization techniques)

  • Functional analysis:

    • Isothermal titration calorimetry (ITC) for binding studies, similar to methods used for other Erwinia proteins

    • Reconstitution into liposomes or nanodiscs for membrane transport assays

    • In silico modeling based on amino acid sequence to predict functional domains

  • Interaction studies:

    • Pull-down assays using the fusion tag to identify binding partners

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Crosslinking studies followed by mass spectrometry for protein-protein interaction mapping

These methodologies should be adapted to account for the membrane protein nature of ECA3038, which presents unique challenges compared to soluble proteins.

How can researchers overcome common challenges in membrane protein expression?

Membrane proteins like ECA3038 present specific challenges that can be addressed through strategic approaches:

  • Toxicity to host cells: Use tightly regulated inducible promoters and consider specialized host strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression

  • Protein aggregation: Incorporate solubility-enhancing fusion partners (MBP, NusA, or TrxA) and optimize expression temperature (typically lowering to 16-25°C)

  • Improper membrane insertion: Validate signal sequence functionality and consider using host-specific signal sequences rather than native ones

  • Low yield: Implement fed-batch cultivation techniques similar to those used for other Erwinia proteins, which have achieved yields of approximately 3660 U/g cells

  • Protein instability: Incorporate stabilizing mutations based on computational predictions or directed evolution approaches

For ECA3038 specifically, the E. coli strains BL21(DE3) and Rosetta-GAMI have demonstrated successful expression when combined with appropriate vector systems and induction protocols .

What methods can verify proper folding and membrane integration of recombinant ECA3038?

Verifying correct folding and membrane integration is critical for functional studies:

  • Subcellular fractionation: Separate membrane fractions to confirm localization

  • Protease accessibility assays: Determine topology by selective protease treatment of intact membrane vesicles

  • Fluorescence-based approaches: Use GFP fusion constructs to visualize membrane localization

  • Limited proteolysis: Compare digestion patterns between recombinant and native protein

  • Functional assays: Develop activity tests based on putative functions of UPF0208 family proteins

These verification steps should be completed before proceeding with functional characterization to ensure that observations reflect properties of correctly folded and properly integrated protein.

What are emerging technologies for studying membrane proteins like ECA3038?

Several cutting-edge methodologies show promise for advancing ECA3038 research:

  • Cryo-electron microscopy: Recent advances have made membrane protein structure determination more accessible without crystallization

  • Nanodiscs and lipid cubic phase technologies: Improve stability and enable functional studies in near-native lipid environments

  • AlphaFold and related AI tools: Predict structures with increasing accuracy, especially valuable for membrane proteins which are challenging to crystallize

  • Single-molecule tracking: Investigate dynamics and interactions in living bacterial systems

  • Microfluidic approaches: Enable high-throughput screening of expression and purification conditions

Researchers are encouraged to explore these emerging methodologies alongside established techniques to overcome the unique challenges presented by membrane proteins like ECA3038.

How does ECA3038 compare to homologous proteins in other bacterial species?

Comparative analysis reveals important evolutionary and functional insights:

  • UPF0208 family proteins are widely distributed across bacterial species, suggesting conservation of an important biological function

  • Sequence alignment shows conserved motifs in the transmembrane domains, particularly in residues facing the lipid bilayer

  • Related DUF412 domain-containing proteins have been implicated in membrane integrity and stress response pathways

  • Differences in amino acid composition at key positions may relate to species-specific adaptation to different environments

This comparative approach can guide hypothesis generation about ECA3038 function based on better-characterized homologs in related bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.