Recombinant Erwinia carotovora subsp. atroseptica UPF0259 membrane protein ECA2305 (ECA2305)

Shipped with Ice Packs
In Stock

Description

ECA2305 is produced via bacterial expression, purified using affinity chromatography (His-tag), and lyophilized or stored in glycerol to maintain stability .

ParameterRecommendation
ReconstitutionSterile deionized water (0.1–1.0 mg/mL) with 5–50% glycerol
Storage-20°C or -80°C; avoid repeated freeze-thaw cycles
StabilityStable for >12 months at -80°C

Experimental Applications

Recombinant ECA2305 is used in:

  1. Structural Studies: Crystallization or cryo-EM to resolve membrane topology.

  2. Functional Assays: Enzymatic activity tests or lipid-binding assays.

  3. Immunological Studies: ELISA or Western blotting for antibody development .

Unexplored Functional Roles

  • Pathogenicity: Pectobacterium atrosepticum causes plant diseases; ECA2305’s role in virulence or membrane integrity is uncharacterized.

  • Membrane Interactions: No data on lipid binding or protein complexes involving ECA2305.

  • Evolutionary Context: Phylogenetic analysis of UPF0259 proteins across bacterial species is lacking.

Emerging Methodologies

  • MCP Prediction: Machine learning models could predict lipid-contacting residues in ECA2305 .

  • Membrane Mimetics: Peptidisc or SMA polymer systems for studying ECA2305 in native-like environments .

  • Proteomic Profiling: Co-fractionation with membrane complexes (e.g., BAM, Sec translocon) to identify interactors .

Comparative Analysis of Membrane Proteins

FeatureECA2305Representative α-Helix Protein (e.g., NhaP2)Representative β-Barrel Protein (e.g., OmpC)
StructureUnknownTransmembrane helicesβ-Barrel
FunctionHypotheticalIon transportPorin activity
Experimental ToolsLimitedMD simulations, mutagenesisBN-PAGE, β-signal motifs
Pathogenic RoleUnclearpH regulationOuter membrane integrity

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
ECA2305; UPF0259 membrane protein ECA2305
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
ECA2305
Target Protein Sequence
MPITANTLYRDTMNFTRNQLISILMMSLLTAFITVILNHALSPSGDELQILSSSSSDLSS SVESGLMDLIQQMTPEQQTVLLKMSAAGTFAALVGNVLLTGGVLMLIQLVSDGQRTSALR AIGASAPFLLRLLFLILLCTLLIQLGMMLLVIPGVLLAIALSLSPVIVVTEKSGIFSAIK TSTKLAYSNLRATAPAIVMWLLAKIAILLIVSKLPISSPTVLSVVLNGLSNLISAILLIY LFRLYMLLRA
Uniprot No.

Target Background

Database Links

KEGG: eca:ECA2305

STRING: 218491.ECA2305

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is currently known about the function of ECA2305?

The precise biological function of ECA2305 remains largely uncharacterized. As a UPF0259 family member, it belongs to a group of proteins with unknown function (UPF stands for Uncharacterized Protein Family). Like many membrane proteins, ECA2305 may play roles in transport, signaling, or maintaining membrane integrity in Pectobacterium atrosepticum. Current research approaches focus on heterologous expression and structural characterization as preliminary steps toward understanding its function. Comparative genomic analysis with other bacterial species may provide insights into conserved domains and potential functional roles.

How can I analyze the transmembrane topology of ECA2305?

The transmembrane topology of ECA2305 can be analyzed through both computational prediction and experimental approaches:

  • Computational methods:

    • Use prediction algorithms like TMHMM, TMpred, or MEMSAT to identify potential membrane-spanning regions

    • Apply hydropathy plot analysis to identify hydrophobic stretches likely to span the membrane

    • Perform multiple sequence alignments with homologous proteins to identify conserved topological features

  • Experimental approaches:

    • Cysteine scanning mutagenesis coupled with accessibility studies

    • Protease protection assays with the recombinant protein reconstituted in liposomes

    • Fluorescence-based techniques using strategically placed reporter groups

    • Epitope insertion and accessibility studies in membrane-reconstituted systems

The most reliable topology model will come from combining both computational predictions and experimental validation.

What expression systems are most suitable for recombinant ECA2305 production?

For membrane proteins like ECA2305, selecting an appropriate expression system is critical. The following approaches are recommended:

  • E. coli-based systems:

    • BL21(DE3) derivatives optimized for membrane protein expression such as C41(DE3) or C43(DE3), which contain mutations in the lacUV5 promoter that reduce expression levels and mitigate toxicity

    • Tunable expression systems using weaker promoters to control expression rate

    • Cold-shock inducible systems that slow protein synthesis and may improve folding

  • Alternative expression strategies:

    • Secretion to the periplasm using signal peptides like PelB, DsbA, or OmpA which may improve folding and reduce toxicity

    • SRP-dependent targeting using appropriate signal sequences (such as DsbA) that facilitate co-translational membrane insertion

For ECA2305, using specialized E. coli strains like C41(DE3) with careful induction control is recommended as an initial approach based on successful expression of similar membrane proteins.

What purification protocol is recommended for His-tagged ECA2305?

The purification of His-tagged ECA2305 requires a carefully optimized protocol:

  • Cell lysis and membrane preparation:

    • Harvest cells by centrifugation and resuspend in buffer containing protease inhibitors

    • Lyse cells using mechanical disruption (sonication or French press)

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization:

    • Solubilize membrane fraction with mild detergents (DDM, LMNG, or LDAO)

    • Optimize detergent concentration and solubilization time

    • Remove insoluble material by ultracentrifugation

  • Affinity purification:

    • Apply solubilized material to Ni-NTA or TALON resin

    • Wash with buffer containing low imidazole to reduce non-specific binding

    • Elute with buffer containing 250-500 mM imidazole

  • Further purification:

    • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

    • Consider ion exchange chromatography as an additional polishing step

  • Storage:

    • Store at -20°C/-80°C in buffer containing 6% trehalose at pH 8.0

    • Aliquot to avoid repeated freeze-thaw cycles

    • For working stocks, store at 4°C for up to one week

How can I improve the yield of functional ECA2305?

Optimizing the yield of functional ECA2305 requires addressing several aspects of the expression and purification process:

  • Expression optimization:

    • Test different expression temperatures (typically 18-30°C)

    • Optimize induction conditions (inducer concentration and induction time)

    • Consider co-expression with chaperones like GroEL/GroES

    • Use specialized media formulations for membrane protein expression

  • Solubilization screening:

    • Systematic screening of different detergents and lipids

    • Test detergent mixtures that may better maintain protein stability

    • Consider using lipid-like surfactants such as amphipols or peptidiscs

  • Stabilization strategies:

    • Add specific lipids during purification that may be required for stability

    • Include glycerol (5-10%) in all buffers to stabilize the protein

    • Optimize buffer composition (pH, salt concentration, additives)

    • Consider addition of substrate or ligand if known

A systematic approach to optimization, testing multiple conditions in parallel, will maximize the chances of obtaining high yields of functional ECA2305.

What membrane reconstitution methods are appropriate for ECA2305?

Several membrane reconstitution methods can be employed for ECA2305, depending on the intended downstream applications:

  • Liposome reconstitution:

    • Conventional method using detergent removal by dialysis or Bio-Beads

    • Suitable for functional assays including transport studies

    • Recommended lipid compositions: E. coli total lipid extract or mixtures of POPE/POPG

  • Nanodiscs:

    • Reconstitution using MSP (Membrane Scaffold Protein) of appropriate size

    • Provides a defined lipid environment and accessible protein surface

    • Requires optimization of protein:lipid:MSP ratio

    • Suitable for structural studies by cryo-EM, NMR, or biochemical analysis

  • Saposin Lipid Nanoparticles (SapNPs):

    • Alternative to nanodiscs using saposin A as the scaffold protein

    • Advantage of flexible scaffold that adapts to protein size

    • Reconstitution protocol similar to nanodiscs but with simplified optimization

    • Useful for both functional and structural studies

  • Peptidiscs:

    • Reconstitution using amphipathic peptides

    • Compatible with membrane proteins of varying sizes and topologies

    • Potentially suitable for ECA2305 given its multi-transmembrane domain structure

For initial characterization of ECA2305, SapNPs represent an attractive option due to the flexible scaffold that can accommodate various membrane protein sizes without needing to screen multiple scaffold variants .

How can I assess proper folding of recombinant ECA2305?

Assessing the proper folding of membrane proteins like ECA2305 is challenging but can be approached through several complementary methods:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to examine tertiary structure (if tryptophan residues are present)

    • Thermal stability assays (such as nanoDSF or CPM assay) to measure unfolding transitions

  • Homogeneity assessment:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Mass photometry to evaluate size distribution of protein-detergent complexes

    • Negative stain electron microscopy to visualize particle homogeneity

  • Functional indicators:

    • Ligand binding assays (if ligands are known)

    • Specific antibody recognition of conformational epitopes

    • Protease resistance compared to denatured controls

A protein that shows expected secondary structure content, homogeneous size distribution, and thermal stability consistent with a folded state provides good evidence for proper folding.

What techniques are recommended for studying ECA2305 protein-protein interactions?

Investigating ECA2305 protein-protein interactions requires specialized approaches suitable for membrane proteins:

  • In vitro interaction studies:

    • Pull-down assays using the His-tag on ECA2305 as bait

    • Surface plasmon resonance with reconstituted ECA2305

    • Microscale thermophoresis for quantitative binding measurements

    • Crosslinking coupled with mass spectrometry to identify interaction partners

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • In vivo crosslinking followed by co-immunoprecipitation

    • FRET-based interaction studies with fluorescently labeled proteins

  • Structural approaches:

    • Cryo-EM of complexes reconstituted in nanodiscs or SapNPs

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Solid-state NMR of labeled protein in membrane mimetics

The choice of method depends on whether potential interaction partners are already known or if the study aims to discover new interactions.

What considerations are important for site-directed mutagenesis of ECA2305?

When designing site-directed mutagenesis experiments for ECA2305, consider the following:

  • Target selection:

    • Conserved residues identified through multiple sequence alignments

    • Residues in predicted functional domains or motifs

    • Charged residues within transmembrane regions (often functionally important)

    • Residues at predicted lipid-protein interfaces

  • Mutation design:

    • Conservative substitutions to minimize structural disruption

    • Alanine scanning for initial functional mapping

    • Cysteine substitutions for accessibility studies or crosslinking

    • Introduction of reporter groups (fluorescent amino acids, spin labels)

  • Expression and folding controls:

    • Monitor expression levels relative to wild-type protein

    • Assess membrane integration and folding for each mutant

    • Use thermal stability assays to detect destabilizing mutations

  • Functional characterization:

    • Develop assays to measure functional parameters affected by mutations

    • Consider reconstitution into proteoliposomes for functional studies

    • Compare activity profiles across multiple mutations to identify patterns

A systematic approach starting with alanine scanning of conserved regions followed by more targeted substitutions based on initial results is recommended.

How can I address protein toxicity issues when expressing ECA2305?

Membrane protein toxicity during expression is a common challenge that can be addressed through several strategies:

  • Expression system modifications:

    • Use specialized strains like C41(DE3) or C43(DE3) specifically developed for toxic membrane proteins

    • These strains contain mutations in the lacUV5 promoter that reduce expression levels

    • Consider lower-copy-number plasmids to reduce basal expression

  • Expression control:

    • Use tightly regulated promoters to minimize leaky expression

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Shorter induction times with higher cell densities

  • Secretion strategies:

    • Direct the protein to the periplasm using appropriate signal sequences

    • Use Sec or SRP pathways depending on protein characteristics

    • Signal peptides from LamB, OmpA, PelB or DsbA can be considered

  • Media optimization:

    • Use buffered media to maintain optimal pH

    • Supplement with additional nutrients or osmolytes

    • Consider auto-induction media for gradual protein expression

Monitoring growth curves before and after induction can provide valuable information about toxicity levels and the effectiveness of mitigation strategies .

What strategies can improve the solubility and stability of purified ECA2305?

Improving the solubility and stability of membrane proteins like ECA2305 requires careful optimization of conditions:

  • Detergent optimization:

    • Screen multiple detergent types (maltoside, glucoside, and fos-choline series)

    • Test detergent mixtures which sometimes provide better stability

    • Consider lipid-like surfactants such as amphipols, SMALPs, or nanodiscs

  • Buffer optimization:

    • Test various pH conditions around the theoretical pI of the protein

    • Optimize salt concentration and type (e.g., NaCl vs. KCl)

    • Add stabilizing agents: glycerol, trehalose, specific lipids, or cholesterol

  • Additive screening:

    • Use thermal shift assays to screen stabilizing compounds

    • Consider specific ligands if known

    • Test different lipid additives that may be required for stability

    • Include specific metal ions if binding sites are predicted

  • Storage considerations:

    • Avoid repeated freeze-thaw cycles as recommended in the product notes

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, maintain at -20°C/-80°C with 5-50% glycerol addition

    • Use buffer containing 6% trehalose at pH 8.0 as recommended

A systematic approach to optimization, testing multiple conditions in parallel, will maximize the chances of maintaining stable, soluble ECA2305.

How can I validate the functionality of recombinant ECA2305?

Since the specific function of ECA2305 is not well-characterized, validating its functionality presents unique challenges. Consider these approaches:

  • Comparative analysis:

    • Compare properties with homologous proteins of known function

    • Analyze conserved residues and structural motifs

    • Use computational prediction tools to suggest potential functions

  • Binding studies:

    • Screen for potential ligands using thermal shift assays

    • Perform binding assays with predicted substrates based on sequence similarity

    • Consider label-free technologies like SPR or BLI to identify interactions

  • Reconstitution experiments:

    • Reconstitute in liposomes and assess effects on membrane properties

    • Measure potential transport activities using fluorescent probes

    • Co-reconstitute with potential interaction partners identified through bioinformatics

  • In vivo complementation:

    • Attempt functional complementation in knockout strains of homologous genes

    • Analyze phenotypic effects of overexpression in native or heterologous hosts

    • Assess impact on membrane integrity or cellular processes

While challenging, a combination of these approaches can provide insights into the functional state of recombinant ECA2305 even without detailed knowledge of its native function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.