Recombinant Erwinia carotovora subsp. atroseptica UPF0442 protein ECA3865 (ECA3865)

What is Recombinant Erwinia carotovora subsp. atroseptica UPF0442 protein ECA3865?

Recombinant Erwinia carotovora subsp. atroseptica UPF0442 protein ECA3865 is a full-length protein (156 amino acids) derived from Pectobacterium atrosepticum. It is typically produced with an N-terminal His tag through expression in E. coli expression systems. The protein is characterized by its unique amino acid sequence: MGLSLLWALLQDMVLAAVPALGFAMVFNVPLKVLPYCALLGGVGHGVRFLAIHFGMNIEWASFLAAILIGIIGIRWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEALMSVMMTNFLKASFIVGALSIGLSLPGIWLYRKRPGV .

What are the optimal storage conditions for ECA3865 protein?

For optimal stability and activity maintenance, ECA3865 protein should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios to prevent protein degradation. The lyophilized powder is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability during storage, it is recommended to add glycerol to a final concentration between 5-50% (with 50% being the standard recommendation). Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For short-term storage, working aliquots can be maintained at 4°C for up to one week .

What buffer systems are compatible with ECA3865 protein?

The ECA3865 protein is typically supplied in a Tris/PBS-based buffer system containing 6% Trehalose at pH 8.0. This formulation helps maintain protein stability during storage and reconstitution. When designing experiments, researchers should consider buffer compatibility and pH stability requirements for specific assays. If buffer exchange is necessary, methods such as dialysis, gel filtration, or centrifugal filtration should be performed with care to maintain protein integrity. For optimal activity, buffer systems should maintain physiological ionic strength and appropriate pH (typically 7.2-8.0) unless specific experimental conditions require otherwise .

How should I design experiments to study functional aspects of ECA3865 protein?

When designing experiments to investigate the functional properties of ECA3865 protein, follow these methodological steps:

• Define clear variables: Establish your independent variable (e.g., protein concentration, interaction with substrates) and dependent variable (e.g., binding affinity, enzymatic activity) .

• Formulate testable hypotheses: Based on the protein's predicted transmembrane structure (evident from its amino acid sequence), hypothesize specific functional roles such as transport activity or membrane signaling .

• Design appropriate treatments: Include relevant controls (negative controls without protein, positive controls with well-characterized similar proteins) and experimental conditions testing specific functional aspects .

• Consider experimental approach: Use both in vitro approaches (purified protein assays) and potentially in vivo approaches (expression in model organisms) to comprehensively characterize function.

• Plan measurement methods: Determine appropriate assays for detecting activity, such as spectroscopic measurements, binding assays, or functional complementation studies .

A well-designed experiment would test multiple concentrations of the protein under varied conditions, with appropriate replicates to ensure statistical significance of findings.

What are the key considerations for protein-protein interaction studies with ECA3865?

Protein-protein interaction studies for ECA3865 require careful experimental design:

The membrane-associated nature of ECA3865 based on its sequence characteristics may necessitate the use of detergents or other solubilizing agents when studying its interactions .

How can structural analysis be performed on ECA3865 protein?

Structural analysis of ECA3865 requires a multi-technique approach:

For ECA3865, begin with circular dichroism (CD) spectroscopy to determine secondary structure composition, particularly the alpha-helical content suggested by the hydrophobic regions in its sequence. Homology modeling based on related UPF0442 family proteins can provide initial structural insights. For crystallography approaches, detergent screening is critical due to the protein's apparent membrane association. Consider removing the His-tag after purification if it interferes with crystal formation. For NMR studies, express the protein in minimal media supplemented with 15N-ammonium chloride and 13C-glucose as the sole nitrogen and carbon sources to produce isotopically labeled protein .

What approaches are recommended for studying ECA3865's role in Pectobacterium atrosepticum pathogenicity?

Studying ECA3865's potential role in pathogenicity requires comprehensive experimental approaches:

• Gene knockout studies: Create ECA3865 deletion mutants in Pectobacterium atrosepticum using CRISPR-Cas9 or homologous recombination techniques. Compare virulence phenotypes with wild-type strains in plant infection assays.

• Complementation analysis: Reintroduce wild-type and site-directed mutant versions of ECA3865 to confirm phenotypic restoration and identify critical functional residues.

• Expression profiling: Perform RNA-seq or qRT-PCR to determine if ECA3865 expression changes during infection stages or in response to plant defense molecules.

• Protein localization: Use fluorescent protein fusions or immunolocalization to determine subcellular localization during host interaction.

• Interactome analysis: Identify host proteins that interact with ECA3865 using co-immunoprecipitation followed by mass spectrometry or yeast two-hybrid screening against plant protein libraries.

• Comparative genomics: Analyze conservation of ECA3865 across related plant pathogenic bacteria to infer evolutionary importance.

How can I improve protein solubility when working with recombinant ECA3865?

The amino acid sequence of ECA3865 suggests it contains hydrophobic regions that may affect solubility . To improve solubility:

• Expression optimization:

  • Test multiple E. coli strains (BL21(DE3), Rosetta, C41/C43 for membrane proteins)

  • Lower induction temperature (16-20°C)

  • Reduce IPTG concentration (0.1-0.5 mM)

  • Use auto-induction media for gradual protein expression

• Buffer optimization:

  • Screen different pH conditions (typically 7.0-8.5)

  • Test various salt concentrations (100-500 mM NaCl)

  • Add solubility enhancers (0.5-1% Triton X-100, 0.1-2% CHAPS, 5-10% glycerol)

  • Include stabilizing agents (1-5 mM DTT or β-mercaptoethanol, 1-5 mM EDTA)

• Protein engineering approaches:

  • Express protein with solubility-enhancing fusion partners (MBP, SUMO, GST)

  • Consider expressing functional domains separately if full-length proves challenging

• Purification strategies:

  • Implement on-column refolding during His-tag purification

  • Use size exclusion chromatography to remove aggregates

  • Include 5-10% glycerol in all purification buffers

When reconstituting lyophilized ECA3865, add reagents slowly while gently mixing to prevent protein aggregation .

What are the recommended approaches for resolving contradictory results in ECA3865 functional assays?

When faced with contradictory results in functional assays of ECA3865:

• Systematic validation of protein quality:

  • Verify protein integrity through SDS-PAGE and western blotting

  • Assess protein folding using circular dichroism or fluorescence spectroscopy

  • Confirm tag accessibility through small-scale binding assays

  • Evaluate batch-to-batch consistency with activity benchmarking

• Experimental parameter analysis:

  • Create a comprehensive matrix of all variables (temperature, pH, buffer composition, incubation time)

  • Systematically isolate and test each parameter individually

  • Document detailed protocols to identify subtle methodological differences

• Independent technique confirmation:

  • Employ at least three different methodological approaches to measure the same parameter

  • Cross-validate results between in vitro biochemical assays and cellular systems

  • Collaborate with laboratories using different approaches for external validation

• Statistical rigor enhancement:

  • Increase sample sizes and number of independent replicates

  • Apply appropriate statistical tests for the data distribution type

  • Perform power analysis to ensure adequate statistical sensitivity

• Literature-based reconciliation:

  • Conduct systematic literature review for related UPF0442 family proteins

  • Consider evolutionary conservation patterns that might explain functional variations

  • Develop working hypotheses that could explain apparently contradictory outcomes

When documenting research, maintain transparent reporting of all conditions and contradictions to facilitate future resolution of discrepancies .

What statistical approaches are appropriate for analyzing ECA3865 binding kinetics data?

When analyzing binding kinetics data for ECA3865:

• Model selection:

  • For simple 1:1 binding: Apply Langmuir binding model

  • For complex binding with multiple sites: Use heterogeneous ligand model

  • For cooperative binding: Implement Hill equation analysis

• Fitting procedures:

  • Employ nonlinear regression rather than linearization methods

  • Use global fitting across multiple concentrations simultaneously

  • Apply weighted fitting if data quality varies across measurement range

• Parameter extraction:

  • Calculate kon (association rate), koff (dissociation rate), and KD (equilibrium dissociation constant)

  • Determine confidence intervals for each parameter

  • Compare thermodynamic parameters (ΔH, ΔS, ΔG) if temperature variation studies performed

• Quality control metrics:

  • Report χ² or residual sum of squares to evaluate goodness of fit

  • Calculate signal-to-noise ratio to assess data quality

  • Include residual plots to detect systematic deviations from models

• Validation approaches:

  • Perform Monte Carlo simulations to estimate parameter robustness

  • Compare results across independent experimental methods

  • Conduct sensitivity analysis to identify critical experimental variables

Example results table for ECA3865 binding analysis:

Use these statistical approaches consistently across experiments to enable reliable comparisons between different binding partners or conditions .

How should I approach literature review when researching ECA3865 and related UPF0442 family proteins?

A systematic literature review on ECA3865 and related UPF0442 proteins should follow these methodological steps:

• Define the review scope:

  • Formulate clear research questions focused on specific aspects of ECA3865

  • Determine inclusion/exclusion criteria for studies (e.g., experimental methods, organism systems)

  • Establish the time frame for literature coverage (consider both historical context and recent advances)

• Develop comprehensive search strategy:

  • Utilize multiple databases (PubMed, Web of Science, SciFinder, UniProt)

  • Create search strings combining protein identifiers, gene names, and functional terms

  • Include related terms (Pectobacterium atrosepticum, Erwinia carotovora, UPF0442 family)

  • Employ citation tracking to identify related studies

• Systematic analysis of findings:

  • Categorize studies by methodology, research focus, and key findings

  • Extract relevant data into standardized formats for comparison

  • Identify methodological strengths and limitations of existing research

  • Synthesize findings to reveal consensus and contradictions in the field

• Critical evaluation:

  • Assess the quality of evidence using established frameworks

  • Identify knowledge gaps requiring further investigation

  • Evaluate relevance of findings to your specific research questions

  • Consider potential biases in published literature

• Synthesis and interpretation:

  • Develop conceptual frameworks that integrate findings

  • Formulate new hypotheses based on literature gaps

  • Create visual representations of current knowledge (concept maps, functional networks)

  • Articulate limitations of current understanding

This systematic approach ensures comprehensive coverage of relevant literature while maintaining critical perspective on the quality and applicability of existing research .

What are promising research directions for understanding ECA3865's biochemical function?

Based on current knowledge and the protein's features, several promising research directions for ECA3865 include:

• Structural biology approaches:

  • High-resolution structure determination through X-ray crystallography or cryo-EM

  • Membrane interaction studies using lipid nanodiscs or bicelles

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Molecular dynamics simulations to predict conformational changes

• Comparative genomics and evolutionary analysis:

  • Phylogenetic profiling across bacterial species to identify co-evolving partners

  • Ancestral sequence reconstruction to trace functional evolution

  • Identification of conserved motifs that might indicate functional domains

  • Synteny analysis to identify genomic context patterns

• Systems biology integration:

  • Network analysis to position ECA3865 within cellular pathways

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Flux analysis to determine impact on cellular metabolism

  • Genome-wide interaction screens (genetic and physical)

• Functional characterization:

  • Site-directed mutagenesis of conserved residues to establish structure-function relationships

  • In vitro reconstitution systems to test transport or signaling hypotheses

  • Development of specific antibodies or activity-based probes

  • Application of emerging technologies like proximity labeling to identify interacting partners

The transmembrane characteristics suggested by the protein's amino acid sequence indicate potential roles in membrane transport, signaling, or maintaining membrane integrity that warrant thorough investigation .

What resources are recommended for researchers new to working with recombinant proteins like ECA3865?

For researchers beginning work with recombinant proteins such as ECA3865, the following educational resources and training approaches are recommended:

• Foundational literature:

  • Protein purification handbooks from major suppliers (GE Healthcare, Qiagen, ThermoFisher)

  • "Guide to Protein Purification" (Methods in Enzymology series)

  • "Current Protocols in Protein Science" for up-to-date methodologies

  • Specialized reviews on membrane-associated proteins

• Online courses and tutorials:

  • Coursera/edX courses on protein biochemistry and recombinant protein expression

  • Protocol repositories such as JoVE (Journal of Visualized Experiments) for video demonstrations

  • Webinars from equipment manufacturers on protein handling techniques

  • Virtual laboratory simulations for protein purification workflows

• Hands-on training opportunities:

  • Workshops offered by core facilities at research institutions

  • Commercial training courses from protein technology suppliers

  • Laboratory rotations with experienced protein biochemistry groups

  • Collaborative projects with established research teams

• Experimental planning tools:

  • Structured experimental design frameworks as outlined in scientific method literature

  • Electronic laboratory notebooks with protein-specific templates

  • Protein analysis software tutorials (for spectroscopic data, binding kinetics, etc.)

  • Statistical analysis resources specific to biochemical data interpretation

• Community resources:

  • Research forums like Research Gate or specialized Slack communities

  • Professional society memberships (Protein Society, American Society for Biochemistry and Molecular Biology)

  • Attendance at focused conferences and symposia

  • Peer mentoring networks for troubleshooting exchange

A systematic approach to skill development should begin with theoretical foundations, progress to supervised practical experience, and culminate in independent experimental design and execution .