Recombinant Erwinia carotovora subsp. atroseptica Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview of Recombinant Erwinia carotovora subsp. atroseptica ZntB (zntB)

Recombinant Erwinia carotovora subsp. atroseptica Zinc transport protein ZntB (zntB) is a transmembrane protein engineered through bacterial expression systems, primarily E. coli, to study its role in zinc homeostasis. ZntB belongs to the CorA metal ion transporter (MIT) family, which facilitates divalent cation transport across cellular membranes . Its recombinant form is widely used in structural and functional studies to elucidate transport mechanisms, substrate specificity, and regulatory dynamics in bacterial zinc metabolism.

Protein Sequence and Expression Parameters

ParameterValue
UniProt IDQ6D5P8
Expression HostE. coli
TagN-terminal 10xHis-tag
Protein LengthFull-length (1–327 amino acids)
Molecular Weight~36.5 kDa (estimated from sequence)
Storage Conditions-20°C (liquid) or -80°C (lyophilized); avoid repeated freezing/thawing

Data sourced from commercial recombinant ZntB product specifications .

Expression and Purification Workflow

  1. Cloning: The zntB gene (Q6D5P8) is cloned into plasmid vectors compatible with E. coli expression systems (e.g., BL21(DE3)) .

  2. Induction: Protein expression is typically induced with IPTG (isopropyl β-D-1-thiogalactopyranoside) under optimized conditions (e.g., 16–18°C, 12–16 hours) .

  3. Purification: Affinity chromatography (Ni-NTA columns) isolates the His-tagged protein, followed by size-exclusion chromatography for homogeneity .

Quality Control and Stability

ParameterSpecification
Purity>90% (SDS-PAGE analysis)
ActivityNot explicitly reported; inferred from homolog function
Shelf Life6 months (liquid) / 12 months (lyophilized) at -20°C/-80°C

Comparative Analysis with Homologs

FeatureZntB (Erwinia)ZntB (E. coli)CorA (Mg²⁺ Transporter)
Substrate SpecificityZn²⁺, Cd²⁺ (inferred)Zn²⁺, Cd²⁺ (validated)Mg²⁺
Transport DirectionUnclearImport (pH-driven)Uptake (channel)
RegulationNot reportedpH gradient-dependentpH-independent

Data synthesized from structural studies and functional assays .

Key Research Findings

  1. Proton Coupling: E. coli ZntB exhibits Zn²⁺/H⁺ symport activity, suggesting a conserved mechanism in Erwinia ZntB .

  2. Metal Tolerance: Overexpression of ZntB in Salmonella enhances Zn²⁺ efflux, reducing metal toxicity .

  3. Structural Flexibility: Unlike CorA, ZntB retains a symmetrical conformation in the absence of divalent cations, hinting at distinct gating mechanisms .

Role in Bacterial Pathogenicity

ZntB homologs in Erwinia spp. may modulate zinc availability during host-pathogen interactions, a critical factor for virulence . For example:

  • Host Zinc Sequestration: Pathogens like Erwinia employ ZntB to scavenge zinc from host environments .

  • Metal Detoxification: Excess Zn²⁺ or Cd²⁺ is expelled via ZntB, protecting bacterial cells .

Biotechnological Potential

  • Metal Bioremediation: Engineered ZntB variants may enhance bacterial metal uptake for environmental cleanup.

  • Antimicrobial Targets: Inhibiting ZntB could disrupt zinc homeostasis in pathogens, offering therapeutic avenues .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
zntB; ECA1993; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Target Names
zntB
Target Protein Sequence
MESFAGKELQHSGAVHAYQLDGKGGITPIGEQDVVNSEKPCWLHLDSTVPASARWLNKTL VVPDSVRTALAGESVRPRVTRLGEGTLITLRSINLNANARPDQLVAVRVFITDKLIISTR RRKILAIDEILTDLKEGNGPTDSGNWLVSIAEALTDHTSEFIDDLHEKIIDLEDDLLEQK IPPRGELALIRKQLIVLRRYMTPQRDVFSRISGEKLPWMQDDDRRRMQEIADRLGRGLED LDASVARTTVLSDEITALMTEAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGGDAP FGFFTFCLMLVILVGGVAWWLKRSKWL
Uniprot No.

Target Background

Function

Mediates efflux of zinc ions.

Database Links

KEGG: eca:ECA1993

STRING: 218491.ECA1993

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its biological significance?

ZntB is a membrane transport protein found in various bacteria, including Erwinia carotovora subsp. atroseptica (now reclassified as Pectobacterium atrosepticum). The protein plays a critical role in zinc homeostasis, which is essential for bacterial survival and virulence. Zinc is a cellular paradox – it is an essential microelement required for numerous cellular processes, yet free zinc ions are highly toxic to cellular machinery when present in excess . ZntB belongs to the CorA family of metal ion transporters and consists of 327 amino acids in its full-length form . The biological significance of ZntB lies in its role in maintaining appropriate zinc levels within bacterial cells, which is particularly important during host-pathogen interactions where zinc availability can be a determining factor in bacterial virulence and survival .

How is zinc homeostasis regulated in bacteria and what role does ZntB play?

Bacteria employ sophisticated mechanisms to maintain optimal zinc concentrations within cells through dedicated import, export, and storage proteins. In Enterobacteriaceae, several membrane transporters collaborate to maintain zinc homeostasis, which is directly linked to virulence . Different bacterial species have evolved various strategies for zinc homeostasis, including zinc storage by metallothioneins in cyanobacteria, assembly of redundant importers as in Cupriavidus metallidurans, or controlled regulation of zinc export-import systems as in Escherichia coli . While ZntB was initially thought to function in zinc export, recent research using cryo-electron microscopy, isothermal titration calorimetry, and reconstituted liposome transport assays has shown that ZntB actually mediates zinc uptake, stimulated by a pH gradient across the membrane . This function is crucial for bacterial survival in zinc-limited environments, particularly during infection when host organisms may actively sequester zinc to reduce bacterial virulence.

What key structural features contribute to ZntB's ion selectivity and transport function?

Several critical structural features enable ZntB's zinc transport function. The protein contains two rings of acidic amino acids at the base of the funnel, which likely play a crucial role in stripping water molecules from zinc ions before they are transported across the membrane . Additionally, ZntB contains specific binding sites for chloride ions, with five localized peaks of electron density discovered in each subunit. These chloride ions appear to tune the electrostatic properties of the funnel, neutralizing positively-charged amino acids just enough to favor the passage of divalent zinc ions rather than monovalent ions like sodium and potassium . The transmembrane domain forms a selective pore that allows zinc ions to pass through while excluding other ions. These structural elements work in concert to create a highly selective transport pathway for zinc ions across the bacterial membrane.

How does the amino acid sequence of ZntB contribute to its function?

The primary structure of ZntB from Erwinia carotovora subsp. atroseptica consists of 327 amino acids with a specific sequence that determines its three-dimensional folding and functional properties . The amino acid sequence of the full-length protein (residues 1-327) includes: "MESFAGKELQHSGAVHAYQLDGKGGITPIGEQDVVNSEKPCWLHLDSTVPASARWLNKTLVVPDSVRTALAGESVRPRVTRLGEGTLITLRSINLNANARPDQLVAVRVFITDKLIISTRRRKILAIDEILTDLKEGNGPTDSGNWLVSIAEALTDHTSEFIDDLHEKIIDLEDDLLEQKIPPRGELALIRKQLIVLRRYMTPQRDVFSRISGEKLPWMQDDDRRRMQEIADRLGRGLEDLDASVARTTVLSDEITALMTEAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGGDAPFGFFTFCLMLVILVGGVAWWLKRSKWL" . This sequence contains regions responsible for zinc binding, oligomerization to form the pentameric complex, and formation of the transmembrane pore. Specific residues within this sequence are involved in chloride ion binding and the formation of the acidic rings that contribute to zinc selectivity. Understanding the relationship between sequence and structure is crucial for interpreting the effects of mutations and for designing experiments to probe ZntB function.

What is the current understanding of zinc transport mechanism by ZntB?

Recent research has fundamentally changed our understanding of ZntB's transport mechanism. Contrary to earlier proposals suggesting that ZntB functions as a zinc exporter, studies using cryo-electron microscopy, isothermal titration calorimetry, and transport assays with reconstituted liposomes have demonstrated that ZntB actually mediates zinc uptake into bacterial cells . This uptake is stimulated by a pH gradient across the membrane, suggesting that ZntB may couple proton movement to zinc transport . The transport mechanism of ZntB differs significantly from that proposed for its homologous protein, the CorA magnesium channel, indicating distinct evolutionary adaptations for different metal ion specificities . The unique structural features of ZntB, including the chloride binding sites and rings of acidic amino acids, contribute to its selective transport of zinc ions while excluding other cellular cations.

How does pH gradient influence ZntB-mediated zinc transport?

The pH gradient across the bacterial membrane plays a critical role in driving ZntB-mediated zinc transport. Research has shown that zinc uptake through ZntB is stimulated by this pH gradient, suggesting a proton-coupled transport mechanism . This coupling likely involves conformational changes in the protein structure that facilitate the movement of zinc ions through the transmembrane pore. The acidic rings at the base of the funnel structure may participate in this process by interacting with protons and zinc ions . The pH dependence of ZntB transport has important implications for bacterial physiology, as changes in environmental pH or intracellular pH regulation could significantly affect zinc homeostasis. This relationship between proton gradient and zinc transport represents an important aspect of bacterial adaptation to different environmental conditions and may be particularly relevant during host-pathogen interactions where pH can vary considerably.

What is the role of chloride ions in ZntB function?

Structural studies of ZntB have revealed an unexpected role for chloride ions in the protein's function. Five localized peaks of electron density were discovered in each subunit of the pentameric complex, which after careful analysis using anomalous diffraction, were identified as chloride ions rather than zinc . These chloride ions appear to play a critical role in tuning the electrostatic properties of the transport funnel. By neutralizing positively charged amino acids within the channel, the chloride ions create an electrostatic environment that favors the passage of divalent zinc ions while discouraging the transport of monovalent cations like sodium and potassium . This selective mechanism ensures that ZntB specifically transports zinc ions rather than other cellular cations. The identification of this chloride-dependent selectivity mechanism represents an important advance in our understanding of metal ion transport specificity and may inform the design of experiments to manipulate ZntB function.

What methods are commonly used to study ZntB structure and function?

Researchers employ various complementary techniques to investigate ZntB structure and function. Cryo-electron microscopy has been instrumental in determining the three-dimensional structure of the full-length ZntB protein from Escherichia coli, revealing its pentameric arrangement and key structural features . X-ray crystallography has been used to resolve the structure of the intracellular domain with high resolution, providing detailed information about chloride binding sites and the acidic rings involved in zinc transport . Functional studies typically employ isothermal titration calorimetry to measure binding affinities and thermodynamic parameters of zinc interaction with ZntB . Transport assays using radiolabeled zinc (65Zn2+) or fluorescent zinc indicators with ZntB reconstituted into liposomes allow direct measurement of transport activity and its dependence on pH gradient or other factors . Site-directed mutagenesis combined with these functional assays helps identify critical residues involved in zinc binding and transport. Together, these methods provide comprehensive insights into the structure-function relationship of ZntB.

How can recombinant ZntB be produced and purified for experimental studies?

Production of recombinant ZntB typically involves expression in bacterial systems, most commonly Escherichia coli. The gene encoding ZntB from Erwinia carotovora subsp. atroseptica can be cloned into an expression vector with an N-terminal His-tag to facilitate purification . For optimal expression, the recombinant protein is often produced in E. coli strains optimized for membrane protein expression, such as BL21(DE3) or its derivatives . Expression can be induced using IPTG under controlled conditions, and fed-batch cultivation techniques can significantly increase protein yield . After cell disruption, the membrane fraction containing ZntB is solubilized using appropriate detergents, and the His-tagged protein is purified using nickel affinity chromatography . For functional studies, the purified protein can be reconstituted into liposomes to create a system that mimics the native membrane environment. This reconstitution allows for controlled studies of transport activity under various conditions . Typical yields using optimized fed-batch techniques can reach approximately 0.9 grams of soluble recombinant protein per liter of culture broth .

What techniques are available for measuring ZntB transport activity?

Several complementary techniques are available for measuring ZntB transport activity in experimental settings. Radioligand uptake assays using 65Zn2+ provide direct quantification of zinc transport into proteoliposomes containing reconstituted ZntB . Fluorescent assays using zinc-sensitive fluorophores such as FluoZin-3 can monitor zinc transport in real-time, allowing for kinetic analysis of transport rates under various conditions . Isothermal titration calorimetry (ITC) offers a label-free approach to determine binding affinities, stoichiometry, and thermodynamic parameters of zinc interaction with ZntB . This technique can also be adapted to measure enzymatic activity by monitoring the heat released or absorbed during transport reactions. For structure-function studies, electrophysiological techniques such as patch-clamp recording or planar lipid bilayer experiments can measure ion currents through ZntB channels directly. Each of these methods has specific advantages and limitations, and combining multiple approaches provides the most comprehensive characterization of ZntB transport activity.

What is the significance of studying ZntB in bacterial pathogenesis research?

Understanding ZntB function has significant implications for bacterial pathogenesis research. Zinc homeostasis plays a crucial role in host-pathogen interactions, often described as a "token coin" in this relationship . During infection, host organisms frequently employ "nutritional immunity" by sequestering zinc at the host-pathogen interface to reduce bacterial virulence . In response, pathogenic bacteria have evolved specialized zinc uptake systems, including ZntB, to scavenge this essential micronutrient . Conversely, in environments where zinc concentrations are elevated as part of host defense, bacteria must regulate intracellular zinc levels to avoid toxicity . ZntB's role in maintaining appropriate zinc levels makes it potentially important for bacterial survival during infection. Research on ZntB contributes to our understanding of how bacterial pathogens, including Erwinia carotovora (Pectobacterium atrosepticum), adapt to changing zinc availability during infection. This knowledge could lead to novel strategies for controlling bacterial infections by targeting zinc homeostasis mechanisms.

How does ZntB research contribute to understanding bacterial adaptation to environmental conditions?

Research on ZntB provides valuable insights into bacterial adaptation to varying environmental conditions, particularly regarding metal ion availability and pH fluctuations. The discovery that ZntB transport activity is stimulated by pH gradients reveals an important mechanism by which bacteria couple energy status to nutrient acquisition . This coupling allows bacteria to respond dynamically to changing environmental conditions, adjusting zinc uptake based on proton motive force across the membrane. The specific structural features of ZntB, such as the chloride binding sites that tune electrostatic properties for zinc selectivity, demonstrate sophisticated molecular adaptations that have evolved to maintain metal homeostasis under varying conditions . Understanding these adaptations contributes to broader knowledge of how bacteria sense and respond to their environment. ZntB research also highlights the diversity of zinc transport systems across bacterial species, reflecting different ecological niches and environmental challenges faced by various bacteria. This comparative perspective enhances our understanding of bacterial evolution and adaptation to diverse habitats.

What potential applications might arise from ZntB research in biotechnology and medicine?

ZntB research has potential applications in both biotechnology and medicine. From a therapeutic perspective, the critical role of zinc homeostasis in bacterial virulence makes ZntB and related transporters potential targets for novel antimicrobial strategies . Compounds that selectively inhibit ZntB function could potentially reduce bacterial virulence or survival during infection, particularly for pathogens where zinc acquisition is a virulence factor. In biotechnology, understanding ZntB structure and function could inform the design of engineered bacteria with enhanced capabilities for environmental applications such as bioremediation of zinc-contaminated sites. The knowledge gained from producing recombinant ZntB in high yields using fed-batch cultivation techniques also has broader applications for membrane protein production in biotechnology . Additionally, the structural insights from ZntB research contribute to our fundamental understanding of selective ion transport across membranes, which has implications for designing synthetic transporters or sensors for zinc and other metals. As antimicrobial resistance continues to pose challenges in medicine, novel targets like ZntB offer promising avenues for developing alternative therapeutic approaches.

How might advanced techniques further our understanding of ZntB function?

Emerging advanced techniques hold promise for addressing current knowledge gaps in ZntB research. Time-resolved cryo-electron microscopy could potentially capture different conformational states during the transport cycle, providing insights into the dynamic structural changes that drive zinc transport. Integration of computational approaches, including molecular dynamics simulations based on experimental structures, could help predict conformational changes and energy landscapes associated with transport. Advanced spectroscopic techniques such as double electron-electron resonance (DEER) spectroscopy could measure distances between strategic locations in the protein during transport, providing experimental validation for proposed conformational changes. Single-molecule fluorescence resonance energy transfer (FRET) could monitor real-time conformational dynamics of individual ZntB complexes during transport. The application of native mass spectrometry could reveal the stoichiometry and stability of the ZntB complex with associated lipids and cofactors. These techniques, combined with genetic approaches in model bacterial systems, would provide a more comprehensive understanding of ZntB function in its native context.

What potential exists for targeting ZntB in antimicrobial development?

The critical role of zinc homeostasis in bacterial physiology and virulence suggests that ZntB could serve as a novel target for antimicrobial development. Several lines of research could be pursued in this direction. Structure-based drug design, utilizing the detailed structural information now available for ZntB, could identify small molecules that selectively bind to and inhibit ZntB function . High-throughput screening approaches could identify compounds that interfere with zinc transport through ZntB, potentially compromising bacterial survival under zinc-limited conditions typical during infection. Peptide-based inhibitors designed to block the transport channel or disrupt the pentameric assembly could offer another strategy for ZntB inhibition. The discovery that chloride ions play a role in tuning ZntB selectivity suggests that compounds altering this electrostatic tuning might disrupt proper function . Additionally, the pH-dependence of ZntB transport suggests that compounds disrupting the coupling between proton gradient and zinc transport could selectively target this transport mechanism . As zinc acquisition systems differ between bacterial species and human cells, selective targeting of bacterial ZntB transporters might offer antibacterial effects with minimal host toxicity.

What are the key physical and biochemical properties of recombinant ZntB?

PropertySpecificationReference
Protein LengthFull Length (1-327 amino acids)
Molecular WeightApproximately 37 kDa per monomer
Oligomeric StateHomopentamer
Isoelectric Point (pI)5.8-6.2 (predicted)
Optimal Storage-20°C/-80°C in Tris/PBS-based buffer, pH 8.0, with 6% Trehalose
Recommended ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage
Purity>90% as determined by SDS-PAGE
UniProt IDQ6D5P8

This table summarizes the essential physical and biochemical properties of recombinant ZntB from Erwinia carotovora subsp. atroseptica. These specifications are critical for researchers planning experimental work with this protein, ensuring proper handling, storage, and quality control. Understanding these properties is essential for successful protein expression, purification, and functional studies.

What kinetic parameters characterize ZntB transport activity?

ParameterValueExperimental ConditionMethodReference
Zinc Binding AffinityLow micromolar rangepH 7.4, 25°CIsothermal Titration Calorimetry
Transport RateEnhanced with pH gradientProteoliposomes with pH gradient (inside acidic)Radioligand uptake assay
Substrate SelectivitySpecific for Zn²⁺ over monovalent cationsVariesComparison of transport rates for different ions
Chloride BindingMultiple sites per subunitDetected in crystal structuresX-ray crystallography, anomalous diffraction

This table presents the current understanding of ZntB kinetic parameters. The data highlight the pH-dependent nature of zinc transport and the specificity for zinc ions over other cellular cations. These kinetic parameters provide a framework for designing experiments to investigate ZntB function and for comparing ZntB activity under different experimental conditions or between mutant variants.

What expression systems and conditions yield optimal recombinant ZntB production?

Expression ParameterOptimal ConditionYieldReference
Expression HostE. coli BL21(DE3) or derivativesVaries with specific strain and conditions
Culture MethodFed-batch cultivation with controlled feedingUp to 0.9 g soluble protein per liter
InductionIPTG-induced expressionOptimized for each experimental setup
Temperature25-30°C post-inductionBalances expression rate and proper folding
Biomass YieldUp to 30.7 g dry cell weight per literUnder optimized fed-batch conditions
Purification MethodNickel affinity chromatography for His-tagged protein>90% purity achievable
ReconstitutionInto liposomes for functional studiesVaries with specific protocol

This table outlines the optimal conditions for recombinant ZntB production based on published research. The fed-batch cultivation technique with predetermined exponential feeding rates has proven particularly effective for high-yield production. These parameters provide a starting point for researchers aiming to produce recombinant ZntB for structural or functional studies, though optimization for specific experimental setups may be necessary.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.