Source Organism Erwinia tasmaniensis (strain DSM 17950 / Et1/99)
Amino Acid Sequence MNINATILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQAS ATDQLKKAKDDAQVIIEQANKRRAQILDDAKAEAEQERNKIVTQAQAEIDAERKRAREEL RKQVAmLAVAGAEKIIERSVDEAANSDIVDKLVAEL
Molecular Weight The size of ATP synthase subunit $$ \beta $$ is 51 kDa .
Tag Information The tag type is determined during the production process .
Purity Information not available in the provided documents.
Storage Buffer Tris-based buffer, 50% glycerol, optimized for this protein
Storage Condition Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .
ATP synthase, also known as F-ATPase, is a vital enzyme complex found in the membranes of bacteria, mitochondria, and chloroplasts . It harnesses the energy from a proton gradient to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . The enzyme consists of two main parts: the F0 sector, embedded in the membrane, which acts as a proton channel, and the F1 sector, which protrudes from the membrane and catalyzes ATP synthesis .
The subunit b (atpF) is a component of the F0 sector, essential for the structural integrity and function of the ATP synthase complex . It connects the F1 and F0 sectors, participating in proton translocation and energy transduction .
ELISA assays Recombinant Erwinia tasmaniensis ATP synthase subunit b (atpF) can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect and quantify antibodies against Erwinia tasmaniensis .
Structural studies Recombinant atpF can be used in structural studies to elucidate the detailed molecular structure of the ATP synthase complex and understand its mechanism of action .
Drug discovery ATP synthase is a potential target for developing new antibacterial drugs. Recombinant atpF can be used in drug screening assays to identify compounds that inhibit ATP synthase activity .
Binding assays Recombinant ATP synthase subunit $$ \beta $$ can be used to identify proteins that bind to IL-1$$ \beta $$ .
Genetic Interactions in Erwinia amylovora In Erwinia amylovora, the yibD gene, which may play a role in polysaccharide production, interacts with the rfbX operon. Overexpression of yibD can inhibit amylovoran production, a crucial exopolysaccharide for virulence. This inhibition is suppressed by rfbX. These genetic interactions reveal a connection between lipopolysaccharide (LPS) and exopolysaccharide (EPS) production in Erwinia amylovora .
Trimeric Form of ATP Synthase Subunit $$ \beta $$ The trimeric form of the recombinant ATP synthase subunit $$ \beta $$ binds to IL-1$$ \beta $$ .
Inhibitors of Phytoene Synthase Phytoene synthesis is inhibited by phosphate ions and squalestatin. The I50 value for squalestatin is 15 microM .
KEGG: eta:ETA_34790
STRING: 465817.ETA_34790
Subunit b (atpF) serves as a critical structural component of the F₀ domain in bacterial ATP synthases, functioning as part of the peripheral stalk that connects the membrane-embedded F₀ region to the catalytic F₁ region. Based on structural analyses of bacterial ATP synthases, subunit b forms an extended dimeric structure (b₂) that acts as a stator, preventing the α₃β₃ hexamer from rotating with the central stalk during catalysis . This peripheral stalk architecture is essential for enzyme function, as it helps maintain the structural integrity of the complex while allowing the central rotor (comprising γ, ε, and c-ring subunits) to rotate in response to proton translocation.
The stability of this connection is critical for efficient energy conversion. In bacterial systems like the one observed in Bacillus PS3, the b subunits extend from the membrane as part of the peripheral stalk, connecting to the δ subunit (equivalent to OSCP in mitochondrial systems) . This architecture enables the simple bacterial ATP synthase to perform the same core functions as more complex mitochondrial equivalents.
For recombinant expression of ATP synthase components, including subunit b from Erwinia tasmaniensis, Escherichia coli expression systems have proven most effective due to their simplicity and high yield. Based on successful approaches with other bacterial ATP synthases, the following methodological workflow is recommended:
Vector selection: pET expression vectors (particularly pET21) provide high-level expression under control of the T7 promoter
E. coli strain: BL21(DE3) or C43(DE3) strains are preferred, with the latter being especially suitable for membrane proteins
Expression conditions: Induction with 0.5-1.0 mM IPTG at OD₆₀₀ of 0.6-0.8, followed by expression at 30°C for 4-6 hours
This approach mirrors successful expression strategies used for ATP synthase components from Bacillus PS3, which were effectively expressed in E. coli and subsequently purified for structural analysis .
Confirming proper folding and function of recombinant atpF requires multiple complementary approaches:
SDS-PAGE analysis: Initial verification of expression and approximate molecular weight (~14-16 kDa) similar to other bacterial b subunits
Circular dichroism (CD) spectroscopy: Assessment of secondary structure content, particularly α-helical content expected in the b subunit
Assembly verification: Co-expression with other ATP synthase components followed by BN-PAGE (Blue Native PAGE) to verify complex formation
Functional reconstitution: Incorporation into liposomes or nanodiscs with complementary ATP synthase components to verify contribution to ATP synthesis activity
Each approach provides distinct information about protein quality. For instance, while SDS-PAGE can confirm expression and approximate size, CD spectroscopy provides critical information about secondary structure that indicates proper folding of the predominantly α-helical peripheral stalk components.
Mutations in atpF can significantly impact ATP synthase assembly and stability, requiring sophisticated analysis techniques to characterize. Based on studies of other bacterial ATP synthases, researchers should:
Design site-directed mutations targeting:
Dimerization interface residues between b subunits
Interaction sites with subunit a and the F₁ domain
Transmembrane anchor regions
Implement analytical approaches:
Analytical ultracentrifugation to assess oligomeric state
Thermal shift assays to determine stability changes
Cross-linking mass spectrometry to map interaction interfaces
Conduct functional analyses:
ATPase activity assays to measure impact on catalysis
Proton pumping assays using pH-sensitive fluorophores
Single-molecule FRET to examine conformational dynamics
| Mutation Region | Expected Impact | Analysis Method | Key Parameters |
|---|---|---|---|
| Dimerization interface | Compromised peripheral stalk assembly | Analytical ultracentrifugation | Sedimentation velocity at 40,000 rpm, 20°C |
| F₁ interaction domain | Decoupling of F₁-F₀ regions | Cross-linking MS | BS3 or DSS crosslinkers, tryptic digestion |
| Transmembrane region | Impaired membrane integration | Membrane extraction efficiency | Differential detergent solubilization |
The resulting data can be integrated to develop a comprehensive model of how specific residues contribute to the structural integrity and functional mechanics of the ATP synthase complex.
Comparative structural analysis of ATP synthase components requires complementary approaches to elucidate both sequence-based and structural differences:
Sequence-based comparative analysis:
Structural characterization techniques:
Cryo-EM of the intact ATP synthase complex at 2.5-3.5 Å resolution
X-ray crystallography of isolated peripheral stalk components
NMR spectroscopy for dynamic regions
Computational approaches:
Homology modeling based on existing bacterial ATP synthase structures
Molecular dynamics simulations to examine stability and conformational flexibility
Protein-protein docking to predict interaction interfaces
This comparative approach would reveal both conserved structural elements essential for ATP synthase function and specializations that may reflect adaptation to Erwinia tasmaniensis' ecological niche.
Molecular dynamics (MD) simulations provide valuable insights into dynamic protein behavior that complements experimental structural data. For atpF in ATP synthase:
Simulation system preparation:
Embed the complete ATP synthase complex in a lipid bilayer matching bacterial membrane composition
Solvate with explicit water molecules and appropriate ion concentration
Apply periodic boundary conditions with minimum 10 Å padding
Recommended simulation parameters:
Force fields: CHARMM36m for proteins, CHARMM36 for lipids
Integration timestep: 2 fs with SHAKE algorithm for hydrogen constraints
Temperature: 310 K (or physiological temperature for Erwinia tasmaniensis)
Equilibration: Minimum 100 ns followed by 1 μs production run
Advanced simulation approaches:
Targeted MD to study conformational transitions during rotation
Free energy calculations to assess stability of b-subunit interactions
Coarse-grained simulations for extended timescale dynamics
This approach is supported by previous MD studies of ATP synthase components, such as those examining protonation states of histidine residues in C. thermarum that revealed their influence on ATP binding site stability . Simulations allow detailed examination of how specific residues contribute to protein-protein interfaces and respond to environmental factors like pH changes.
Distinguishing specific from non-specific effects requires rigorous controls and complementary approaches:
Control experiments:
Parallel analysis of well-characterized point mutations with predicted specific effects
Dose-response curves for inhibitors to identify concentration thresholds
Analysis of effects on unrelated membrane proteins to identify non-specific membrane disruption
Structure-activity relationship studies:
Systematic variation of inhibitor chemical structure
Correlation of ATP synthase activity with binding affinity
Competition assays with known ligands or substrates
Direct binding measurements:
Isothermal titration calorimetry to determine binding thermodynamics
Surface plasmon resonance to measure binding kinetics
Fluorescence-based binding assays with site-specific labels
When analyzing mutations, researchers should implement the "6A" approach (similar to the ε6A mutant strategy used with C. thermarum ), where multiple alanine substitutions are introduced to comprehensively evaluate functional impacts. This provides a powerful framework for distinguishing specific molecular interactions from non-specific structural disruptions.
Cryo-EM has revolutionized structural biology of ATP synthases, with optimal conditions for Erwinia tasmaniensis likely similar to those successfully used for other bacterial ATP synthases:
Sample preparation protocol:
Purification in mild detergents (DDM or LMNG at 0.01-0.05%)
Concentration to 2-5 mg/mL
Application of 3 μL to glow-discharged holey carbon grids
Vitrification using Vitrobot (FEI) at 100% humidity, 4°C
Data collection parameters:
300 kV electron microscope (Titan Krios or equivalent)
Direct electron detector with 40 frames per exposure
Total dose: 40-60 e⁻/Ų
Defocus range: -0.8 to -2.5 μm
Image processing workflow:
The success of this approach is evidenced by the high-resolution structures obtained for Bacillus PS3 ATP synthase, which allowed visualization of the membrane region and peripheral stalk components . Similar strategies should be applicable to Erwinia tasmaniensis ATP synthase, potentially revealing unique features relevant to its ecological niche.
Isotope labeling for NMR studies of membrane-associated proteins like atpF requires specialized approaches:
Expression optimization:
M9 minimal media supplemented with ¹⁵N-ammonium chloride and/or ¹³C-glucose
ISOGRO supplemented media for improved yields
Selective amino acid labeling for specific interaction studies
Labeling strategies based on research questions:
Uniform ¹⁵N-labeling for backbone assignments and titration experiments
¹³C,¹⁵N-labeling for complete structure determination
Selective methyl labeling (ILV) for studying dynamics in large complexes
TROSY-based experiments for membrane-associated domains
Sample preparation considerations:
Detergent micelles (DDM, DPC) or nanodiscs for membrane domains
Deuteration to reduce relaxation for larger constructs
Segmental labeling for focusing on specific domains
| Labeling Type | Applications | Experimental Approach | Sample Requirements |
|---|---|---|---|
| Uniform ¹⁵N | Backbone dynamics, Binding studies | HSQC, TROSY | 0.3-0.5 mM protein |
| Selective methyl | Large complex dynamics | 13CH3-HMQC | Deuterated background |
| Segmental | Domain-specific analysis | Split-intein ligation | Separate expression of domains |
This approach enables detailed structural and dynamic information about atpF, particularly focusing on its interaction interfaces with other ATP synthase components.
Several cutting-edge technologies show promise for advancing ATP synthase research:
Cryo-electron tomography for visualizing ATP synthase in native membrane environments
Time-resolved cryo-EM to capture conformational changes during catalytic cycle
Integrative structural biology combining multiple data types (cryo-EM, crosslinking-MS, SAXS)
AlphaFold2 and RoseTTAFold for improved modeling of protein-protein interactions
Single-molecule techniques like FRET and force spectroscopy to observe rotational dynamics
The application of these approaches to Erwinia tasmaniensis ATP synthase would build upon existing knowledge from other bacterial systems , potentially revealing unique features related to its ecological niche and providing insights into bacterial energy metabolism adaptations.
As a plant-associated bacterium, Erwinia tasmaniensis has likely evolved specialized adaptations in its energy metabolism machinery:
pH adaptation mechanisms:
Metabolic integration:
Coordination with plant-specific carbon source utilization
Adaptation to diurnal cycles affecting energy availability
Stress response mechanisms during plant immune activation
Comparative genomic approaches:
Analysis across Erwinia species with different plant associations
Identification of conserved vs. variable ATP synthase components
Correlation of ATP synthase adaptations with ecological niches
These studies would not only advance our understanding of bacterial energy metabolism but also provide insights into the molecular basis of plant-microbe interactions, potentially informing agricultural applications related to plant health and productivity.