Recombinant Erwinia tasmaniensis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Characteristics

  • Source Organism Erwinia tasmaniensis (strain DSM 17950 / Et1/99)

  • Protein Type Recombinant Protein

  • Subunit ATP synthase subunit b (atpF)

  • Uniprot No. B2VCA8

  • Amino Acid Sequence MNINATILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQAS ATDQLKKAKDDAQVIIEQANKRRAQILDDAKAEAEQERNKIVTQAQAEIDAERKRAREEL RKQVAmLAVAGAEKIIERSVDEAANSDIVDKLVAEL

  • Molecular Weight The size of ATP synthase subunit $$ \beta $$ is 51 kDa .

  • Tag Information The tag type is determined during the production process .

  • Purity Information not available in the provided documents.

  • Form Available as a lyophilized powder .

  • Expression Region 1-156

  • Storage Buffer Tris-based buffer, 50% glycerol, optimized for this protein

  • Storage Condition Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

Function and Significance

ATP synthase, also known as F-ATPase, is a vital enzyme complex found in the membranes of bacteria, mitochondria, and chloroplasts . It harnesses the energy from a proton gradient to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . The enzyme consists of two main parts: the F0 sector, embedded in the membrane, which acts as a proton channel, and the F1 sector, which protrudes from the membrane and catalyzes ATP synthesis .

The subunit b (atpF) is a component of the F0 sector, essential for the structural integrity and function of the ATP synthase complex . It connects the F1 and F0 sectors, participating in proton translocation and energy transduction .

Applications

  • ELISA assays Recombinant Erwinia tasmaniensis ATP synthase subunit b (atpF) can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect and quantify antibodies against Erwinia tasmaniensis .

  • Structural studies Recombinant atpF can be used in structural studies to elucidate the detailed molecular structure of the ATP synthase complex and understand its mechanism of action .

  • Drug discovery ATP synthase is a potential target for developing new antibacterial drugs. Recombinant atpF can be used in drug screening assays to identify compounds that inhibit ATP synthase activity .

  • Binding assays Recombinant ATP synthase subunit $$ \beta $$ can be used to identify proteins that bind to IL-1$$ \beta $$ .

Research Findings

  • Genetic Interactions in Erwinia amylovora In Erwinia amylovora, the yibD gene, which may play a role in polysaccharide production, interacts with the rfbX operon. Overexpression of yibD can inhibit amylovoran production, a crucial exopolysaccharide for virulence. This inhibition is suppressed by rfbX. These genetic interactions reveal a connection between lipopolysaccharide (LPS) and exopolysaccharide (EPS) production in Erwinia amylovora .

  • Trimeric Form of ATP Synthase Subunit $$ \beta $$ The trimeric form of the recombinant ATP synthase subunit $$ \beta $$ binds to IL-1$$ \beta $$ .

  • Inhibitors of Phytoene Synthase Phytoene synthesis is inhibited by phosphate ions and squalestatin. The I50 value for squalestatin is 15 microM .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
atpF; ETA_34790; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
atpF
Target Protein Sequence
MNINATILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQAS ATDQLKKAKDDAQVIIEQANKRRAQILDDAKAEAEQERNKIVTQAQAEIDAERKRAREEL RKQVAMLAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of subunit b (atpF) in bacterial ATP synthase complexes?

Subunit b (atpF) serves as a critical structural component of the F₀ domain in bacterial ATP synthases, functioning as part of the peripheral stalk that connects the membrane-embedded F₀ region to the catalytic F₁ region. Based on structural analyses of bacterial ATP synthases, subunit b forms an extended dimeric structure (b₂) that acts as a stator, preventing the α₃β₃ hexamer from rotating with the central stalk during catalysis . This peripheral stalk architecture is essential for enzyme function, as it helps maintain the structural integrity of the complex while allowing the central rotor (comprising γ, ε, and c-ring subunits) to rotate in response to proton translocation.

The stability of this connection is critical for efficient energy conversion. In bacterial systems like the one observed in Bacillus PS3, the b subunits extend from the membrane as part of the peripheral stalk, connecting to the δ subunit (equivalent to OSCP in mitochondrial systems) . This architecture enables the simple bacterial ATP synthase to perform the same core functions as more complex mitochondrial equivalents.

What expression systems are most effective for producing recombinant Erwinia tasmaniensis ATP synthase subunit b?

For recombinant expression of ATP synthase components, including subunit b from Erwinia tasmaniensis, Escherichia coli expression systems have proven most effective due to their simplicity and high yield. Based on successful approaches with other bacterial ATP synthases, the following methodological workflow is recommended:

  • Vector selection: pET expression vectors (particularly pET21) provide high-level expression under control of the T7 promoter

  • E. coli strain: BL21(DE3) or C43(DE3) strains are preferred, with the latter being especially suitable for membrane proteins

  • Expression conditions: Induction with 0.5-1.0 mM IPTG at OD₆₀₀ of 0.6-0.8, followed by expression at 30°C for 4-6 hours

This approach mirrors successful expression strategies used for ATP synthase components from Bacillus PS3, which were effectively expressed in E. coli and subsequently purified for structural analysis .

How can researchers confirm the proper folding and function of recombinant atpF protein?

Confirming proper folding and function of recombinant atpF requires multiple complementary approaches:

  • SDS-PAGE analysis: Initial verification of expression and approximate molecular weight (~14-16 kDa) similar to other bacterial b subunits

  • Circular dichroism (CD) spectroscopy: Assessment of secondary structure content, particularly α-helical content expected in the b subunit

  • Assembly verification: Co-expression with other ATP synthase components followed by BN-PAGE (Blue Native PAGE) to verify complex formation

  • Functional reconstitution: Incorporation into liposomes or nanodiscs with complementary ATP synthase components to verify contribution to ATP synthesis activity

Each approach provides distinct information about protein quality. For instance, while SDS-PAGE can confirm expression and approximate size, CD spectroscopy provides critical information about secondary structure that indicates proper folding of the predominantly α-helical peripheral stalk components.

How do specific mutations in the atpF gene affect the assembly and stability of the ATP synthase complex?

Mutations in atpF can significantly impact ATP synthase assembly and stability, requiring sophisticated analysis techniques to characterize. Based on studies of other bacterial ATP synthases, researchers should:

  • Design site-directed mutations targeting:

    • Dimerization interface residues between b subunits

    • Interaction sites with subunit a and the F₁ domain

    • Transmembrane anchor regions

  • Implement analytical approaches:

    • Analytical ultracentrifugation to assess oligomeric state

    • Thermal shift assays to determine stability changes

    • Cross-linking mass spectrometry to map interaction interfaces

  • Conduct functional analyses:

    • ATPase activity assays to measure impact on catalysis

    • Proton pumping assays using pH-sensitive fluorophores

    • Single-molecule FRET to examine conformational dynamics

Mutation RegionExpected ImpactAnalysis MethodKey Parameters
Dimerization interfaceCompromised peripheral stalk assemblyAnalytical ultracentrifugationSedimentation velocity at 40,000 rpm, 20°C
F₁ interaction domainDecoupling of F₁-F₀ regionsCross-linking MSBS3 or DSS crosslinkers, tryptic digestion
Transmembrane regionImpaired membrane integrationMembrane extraction efficiencyDifferential detergent solubilization

The resulting data can be integrated to develop a comprehensive model of how specific residues contribute to the structural integrity and functional mechanics of the ATP synthase complex.

How does the structure of Erwinia tasmaniensis atpF compare to homologs from other bacterial species, and what techniques best reveal these differences?

Comparative structural analysis of ATP synthase components requires complementary approaches to elucidate both sequence-based and structural differences:

  • Sequence-based comparative analysis:

    • Multiple sequence alignment to identify conserved and variant regions

    • Evolutionary analysis to determine selective pressure on specific domains

    • Identification of unique residues, particularly histidines that might confer pH sensitivity

  • Structural characterization techniques:

    • Cryo-EM of the intact ATP synthase complex at 2.5-3.5 Å resolution

    • X-ray crystallography of isolated peripheral stalk components

    • NMR spectroscopy for dynamic regions

  • Computational approaches:

    • Homology modeling based on existing bacterial ATP synthase structures

    • Molecular dynamics simulations to examine stability and conformational flexibility

    • Protein-protein docking to predict interaction interfaces

Bacterial SpeciesKey Structural Features of b SubunitUnique PropertiesResolution Method
Bacillus PS3Part of ab₂c₁₀ membrane regionThermal stabilityCryo-EM (3.0 Å)
E. coliExtended α-helical structure in peripheral stalk-Cryo-EM and X-ray crystallography
C. thermarumContains unique histidine residuespH-dependent activityCrystallography and MD simulations
Erwinia tasmaniensisPredicted to have plant-adaptation featuresUnknownHomology modeling recommended

This comparative approach would reveal both conserved structural elements essential for ATP synthase function and specializations that may reflect adaptation to Erwinia tasmaniensis' ecological niche.

What molecular dynamics simulation protocols best capture the behavior of atpF in the context of the complete ATP synthase complex?

Molecular dynamics (MD) simulations provide valuable insights into dynamic protein behavior that complements experimental structural data. For atpF in ATP synthase:

  • Simulation system preparation:

    • Embed the complete ATP synthase complex in a lipid bilayer matching bacterial membrane composition

    • Solvate with explicit water molecules and appropriate ion concentration

    • Apply periodic boundary conditions with minimum 10 Å padding

  • Recommended simulation parameters:

    • Force fields: CHARMM36m for proteins, CHARMM36 for lipids

    • Integration timestep: 2 fs with SHAKE algorithm for hydrogen constraints

    • Temperature: 310 K (or physiological temperature for Erwinia tasmaniensis)

    • Equilibration: Minimum 100 ns followed by 1 μs production run

  • Advanced simulation approaches:

    • Targeted MD to study conformational transitions during rotation

    • Free energy calculations to assess stability of b-subunit interactions

    • Coarse-grained simulations for extended timescale dynamics

This approach is supported by previous MD studies of ATP synthase components, such as those examining protonation states of histidine residues in C. thermarum that revealed their influence on ATP binding site stability . Simulations allow detailed examination of how specific residues contribute to protein-protein interfaces and respond to environmental factors like pH changes.

How can researchers distinguish between specific and non-specific effects when analyzing inhibitors or mutations of Erwinia tasmaniensis ATP synthase?

Distinguishing specific from non-specific effects requires rigorous controls and complementary approaches:

  • Control experiments:

    • Parallel analysis of well-characterized point mutations with predicted specific effects

    • Dose-response curves for inhibitors to identify concentration thresholds

    • Analysis of effects on unrelated membrane proteins to identify non-specific membrane disruption

  • Structure-activity relationship studies:

    • Systematic variation of inhibitor chemical structure

    • Correlation of ATP synthase activity with binding affinity

    • Competition assays with known ligands or substrates

  • Direct binding measurements:

    • Isothermal titration calorimetry to determine binding thermodynamics

    • Surface plasmon resonance to measure binding kinetics

    • Fluorescence-based binding assays with site-specific labels

When analyzing mutations, researchers should implement the "6A" approach (similar to the ε6A mutant strategy used with C. thermarum ), where multiple alanine substitutions are introduced to comprehensively evaluate functional impacts. This provides a powerful framework for distinguishing specific molecular interactions from non-specific structural disruptions.

What are the optimal conditions for cryo-EM analysis of recombinant Erwinia tasmaniensis ATP synthase containing the atpF protein?

Cryo-EM has revolutionized structural biology of ATP synthases, with optimal conditions for Erwinia tasmaniensis likely similar to those successfully used for other bacterial ATP synthases:

  • Sample preparation protocol:

    • Purification in mild detergents (DDM or LMNG at 0.01-0.05%)

    • Concentration to 2-5 mg/mL

    • Application of 3 μL to glow-discharged holey carbon grids

    • Vitrification using Vitrobot (FEI) at 100% humidity, 4°C

  • Data collection parameters:

    • 300 kV electron microscope (Titan Krios or equivalent)

    • Direct electron detector with 40 frames per exposure

    • Total dose: 40-60 e⁻/Ų

    • Defocus range: -0.8 to -2.5 μm

  • Image processing workflow:

    • Motion correction using MotionCor2

    • CTF estimation with CTFFIND4

    • Particle picking with crYOLO or Topaz

    • Classification and refinement in cryoSPARC or RELION

    • Focused refinement of membrane and peripheral stalk regions

The success of this approach is evidenced by the high-resolution structures obtained for Bacillus PS3 ATP synthase, which allowed visualization of the membrane region and peripheral stalk components . Similar strategies should be applicable to Erwinia tasmaniensis ATP synthase, potentially revealing unique features relevant to its ecological niche.

How can isotope labeling be optimized for NMR studies of recombinant atpF and its interactions?

Isotope labeling for NMR studies of membrane-associated proteins like atpF requires specialized approaches:

  • Expression optimization:

    • M9 minimal media supplemented with ¹⁵N-ammonium chloride and/or ¹³C-glucose

    • ISOGRO supplemented media for improved yields

    • Selective amino acid labeling for specific interaction studies

  • Labeling strategies based on research questions:

    • Uniform ¹⁵N-labeling for backbone assignments and titration experiments

    • ¹³C,¹⁵N-labeling for complete structure determination

    • Selective methyl labeling (ILV) for studying dynamics in large complexes

    • TROSY-based experiments for membrane-associated domains

  • Sample preparation considerations:

    • Detergent micelles (DDM, DPC) or nanodiscs for membrane domains

    • Deuteration to reduce relaxation for larger constructs

    • Segmental labeling for focusing on specific domains

Labeling TypeApplicationsExperimental ApproachSample Requirements
Uniform ¹⁵NBackbone dynamics, Binding studiesHSQC, TROSY0.3-0.5 mM protein
Selective methylLarge complex dynamics13CH3-HMQCDeuterated background
SegmentalDomain-specific analysisSplit-intein ligationSeparate expression of domains

This approach enables detailed structural and dynamic information about atpF, particularly focusing on its interaction interfaces with other ATP synthase components.

What emerging technologies might advance our understanding of Erwinia tasmaniensis ATP synthase function?

Several cutting-edge technologies show promise for advancing ATP synthase research:

  • Cryo-electron tomography for visualizing ATP synthase in native membrane environments

  • Time-resolved cryo-EM to capture conformational changes during catalytic cycle

  • Integrative structural biology combining multiple data types (cryo-EM, crosslinking-MS, SAXS)

  • AlphaFold2 and RoseTTAFold for improved modeling of protein-protein interactions

  • Single-molecule techniques like FRET and force spectroscopy to observe rotational dynamics

The application of these approaches to Erwinia tasmaniensis ATP synthase would build upon existing knowledge from other bacterial systems , potentially revealing unique features related to its ecological niche and providing insights into bacterial energy metabolism adaptations.

How might the study of Erwinia tasmaniensis ATP synthase contribute to understanding bacterial adaptation to plant environments?

As a plant-associated bacterium, Erwinia tasmaniensis has likely evolved specialized adaptations in its energy metabolism machinery:

  • pH adaptation mechanisms:

    • Similar to C. thermarum's pH-dependent ATP binding

    • Potential unique histidine residues in ATP synthase components

    • Adaptation to plant apoplast pH fluctuations

  • Metabolic integration:

    • Coordination with plant-specific carbon source utilization

    • Adaptation to diurnal cycles affecting energy availability

    • Stress response mechanisms during plant immune activation

  • Comparative genomic approaches:

    • Analysis across Erwinia species with different plant associations

    • Identification of conserved vs. variable ATP synthase components

    • Correlation of ATP synthase adaptations with ecological niches

These studies would not only advance our understanding of bacterial energy metabolism but also provide insights into the molecular basis of plant-microbe interactions, potentially informing agricultural applications related to plant health and productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.