Recombinant Erwinia tasmaniensis Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Erwinia tasmaniensis Bifunctional Protein Aas(Aas)

The recombinant Erwinia tasmaniensis bifunctional protein Aas(Aas) (UniProt ID: B2VFS7) is a full-length enzyme (719 amino acids) engineered for research applications. It combines two enzymatic activities: 2-acylglycerophosphoethanolamine acyltransferase and acyl-[acyl-carrier-protein] synthetase, enabling dual roles in lipid metabolism and acyl-ACP synthesis .

Key Features

  • Expression System: Produced in E. coli with an N-terminal His tag for purification .

  • Purity: >90% as determined by SDS-PAGE .

  • Form: Lyophilized powder stored in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Amino Acid Sequence and Domains

The protein’s sequence (1–719 aa) includes motifs critical for substrate binding and catalysis. While specific active-site residues are not explicitly detailed in available sources, its bifunctional nature aligns with conserved enzymatic mechanisms in related acyltransferases .

Functional Roles

Enzymatic ActivityRole
2-acylglycerophosphoethanolamine acyltransferaseTransfers acyl groups to glycerophosphoethanolamine, modifying membrane lipids.
Acyl-[acyl-carrier-protein] synthetaseActivates acyl groups for fatty acid biosynthesis via acyl-ACP intermediates.

Production and Purification Protocols

Reconstitution:

  1. Centrifuge vial briefly.

  2. Dissolve in deionized water (0.1–1.0 mg/mL).

  3. Add 5–50% glycerol (final concentration) for long-term storage .

Potential Uses

  • Lipid Metabolism Studies: Investigating acyltransferase activity in bacterial membrane synthesis.

  • Enzyme Engineering: Exploring catalytic efficiency for industrial or therapeutic applications.

Challenges

  • Stability: Repeated freeze-thaw cycles degrade activity .

  • Substrate Specificity: Limited data on substrate preferences or kinetic parameters (e.g., K<sub>m</sub>, k<sub>cat</sub>).

Comparative Analysis with Homologs

Table 2: Aas Proteins in Erwinia tasmaniensis vs. Escherichia fergusonii

FeatureErwinia tasmaniensis (B2VFS7) Escherichia fergusonii (B7LNJ2)
UniProt IDB2VFS7B7LNJ2
AA Sequence719 aa (His-tagged)719 aa (His-tagged)
Functional SynonymsLon, Acyl-ACP synthetaseLon, Acyl-ACP synthetase

Both proteins share structural homology but differ in species-specific adaptations.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
aas; ETA_27680; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
aas
Target Protein Sequence
MVLTFLRALLRLAFRTRLTGDLASLNKRRVLITPNHMSFLDGILLAVFLPVKPVFAVYSS ISSQWYMRALRSLIDFVPLDPTKPMSVKHLVKLIGQGRPVVIFPEGRITVTGSLMKIYDG AGFVAAKSQATVVPLRIEGAEYTPFGRLGGVVKRRLFPRITLTVLPATTIPMPQAPRARD RRRLAGEHLHHIMMEARMAVRPRETLYQAFLAARTRYGLFKPCIEDVNFKPDSYSGLLKK SLGVGRILERYSQPGEYVGLLLPNATVTAAAILGASMRGRVPAMLNYTAGVKGLTSALTA GEIKTVFTSRQFLDKGKLWHLPQGITQVKWIYLEDLKDTLTTQDKLWILGHLLLPRRAMV AQQPEDAAMVLFTSGSEGHPKGVVHSHKSLLANVEQIRTVADFTPCDRFMSALPLFHAFG LTVGLFTPLMTGARVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFAR LRYVVAGAEKLQDHTRELWMEKYGIRILEGYGVTECAPVVAINVPMAAKSHTVGRILPGM DSRLVSVPGIEQGGRLQLRGPNIMKGYLRVEHPGRLEAPQADNGEGQMEPGWYDTGDIVS FDEGGFCQIQGRVKRFAKIAGEMVSLEIVEQIARNASDDKQHAATIKPDGNRGEALVLFT TDAQLTREQLMHSARELGSPELAVPRDIRLLSQLPLLGSGKPDFVTLREMAEQPEDRRE
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-acyl carrier protein (ACP) intermediate, requiring ATP and magnesium ions. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a product of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the exact function of Recombinant Erwinia tasmaniensis Bifunctional protein aas(aas) in bacterial metabolism?

Recombinant Erwinia tasmaniensis Bifunctional protein aas(aas) is a 719-amino acid protein with two critical functional domains:

  • 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40)

  • Acyl-[acyl-carrier-protein]--phospholipid acyltransferase

This bifunctional enzyme plays a crucial role in bacterial membrane lipid homeostasis and remodeling. The protein catalyzes the transfer of acyl groups in phospholipid metabolism, particularly involving phosphatidylethanolamine. In E. tasmaniensis specifically, this protein is part of the membrane biogenesis machinery that maintains membrane integrity under various environmental conditions .

Unlike other enzymes that require separate proteins for sequential reactions, the bifunctional nature of aas(aas) allows for coordinated acyl-transfer reactions, increasing metabolic efficiency in phospholipid remodeling.

How should researchers optimize expression and purification protocols for Erwinia tasmaniensis Bifunctional protein aas(aas)?

Based on established protocols, researchers should follow these methodological steps for optimal expression and purification:

Expression Protocol:

  • Expression System: E. coli BL21(DE3) or similar strain optimized for membrane-associated protein expression

  • Vector Design: Include N-terminal His-tag for single-step affinity purification

  • Culture Conditions:

    • Initial growth at 37°C to OD600 0.6-0.8

    • Reduce temperature to 18-20°C before induction

    • Induce with 0.1-0.5 mM IPTG

    • Continue expression for 16-18 hours

Purification Protocol:

  • Cell Lysis: Use gentle detergent-based lysis buffer supplemented with protease inhibitors

  • Affinity Chromatography: Nickel or cobalt resin with gradient elution

  • Buffer Composition: Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Storage: 50% glycerol at -20°C/-80°C to prevent activity loss

  • Quality Control: SDS-PAGE and activity assays to confirm intact protein

This approach has been validated to yield >90% pure protein as determined by SDS-PAGE, suitable for functional studies and structural analysis.

What are the optimal storage conditions for maintaining enzymatic activity of Erwinia tasmaniensis Bifunctional protein aas(aas)?

Maintaining enzymatic activity requires strict adherence to these evidence-based storage parameters:

Short-term Storage (≤1 week):

  • Temperature: 4°C

  • Buffer: Tris/PBS-based buffer, pH 8.0 with 6% trehalose

  • Protein Concentration: 0.1-1.0 mg/mL

Long-term Storage:

  • Temperature: -20°C/-80°C

  • Buffer Additives: 50% glycerol final concentration

  • Aliquoting: Small single-use volumes to prevent freeze-thaw cycles

  • Reconstitution: Centrifuge briefly before opening; reconstitute in deionized sterile water

Research indicates that repeated freeze-thaw cycles significantly diminish enzymatic activity. Each freeze-thaw cycle can reduce activity by approximately 15-20%, with complete loss of function typically occurring after 4-5 cycles.

The addition of trehalose specifically helps stabilize membrane-associated proteins like aas(aas) by preventing denaturation during freezing and lyophilization.

How does Erwinia tasmaniensis Bifunctional protein aas(aas) compare structurally and functionally to homologous proteins in related bacterial species?

Comparative analysis reveals significant structural and functional relationships across bacterial species:

SpeciesProtein HomologSequence IdentityFunctional SimilarityNotable Differences
Erwinia tasmaniensisBifunctional protein aas(aas)100% (reference)Complete bifunctionalityBaseline reference
Escherichia coliBifunctional protein aas(aas)~65%Both acyltransferase domains activeDifferent substrate specificity
Salmonella speciesBifunctional protein aas(aas)~60%Similar bifunctionalityHigher thermal stability
Yersinia speciesBifunctional protein aas(aas)~55%Conserved active sitesVariable N-terminal region

The bifunctional nature is conserved across Enterobacteriaceae, suggesting evolutionary preservation of this dual functionality .

The aas proteins from all these species contain the characteristic acyltransferase domains, but E. tasmaniensis shows unique sequence patterns in substrate-binding regions that may contribute to its environmental adaptation to plant surfaces. This adaptation may be related to E. tasmaniensis' role as an epiphytic bacterium on healthy apple and pear trees, where it antagonizes the fire blight pathogen Erwinia amylovora .

What are the key structural features and conserved domains in Erwinia tasmaniensis Bifunctional protein aas(aas)?

Structural analysis of E. tasmaniensis Bifunctional protein aas(aas) reveals several critical domains and features:

Conserved Domains:

  • N-terminal 2-acylglycerophosphoethanolamine acyltransferase domain

  • C-terminal acyl-[acyl-carrier-protein]--phospholipid domain

  • Transmembrane regions for membrane association

How can researchers design specific activity assays to distinguish between the two functional domains of Erwinia tasmaniensis Bifunctional protein aas(aas)?

To effectively distinguish between the two enzymatic functions, researchers should implement these domain-specific assays:

Assay for 2-acylglycerophosphoethanolamine acyltransferase activity:

  • Substrate: 2-acylglycerophosphoethanolamine (lysophosphatidylethanolamine)

  • Acyl donor: Acyl-CoA (various chain lengths)

  • Detection: HPLC analysis of phosphatidylethanolamine formation

  • Controls: Heat-inactivated enzyme, single-domain mutants

Assay for acyl-[acyl-carrier-protein]--phospholipid activity:

  • Substrate: Phospholipid membrane

  • Acyl donor: Acyl-ACP (requires separate ACP production)

  • Detection: Radiolabeled or fluorescently labeled acyl groups

  • Analysis: TLC or mass spectrometry to detect modified phospholipids

Differential Inhibition Strategy:

Use domain-specific inhibitors to selectively block one function while measuring the other:

  • Thiol-reactive compounds to inhibit the first domain

  • Lysophospholipid analogs to competitively inhibit the second domain

What role does Erwinia tasmaniensis Bifunctional protein aas(aas) play in bacterial pathogenicity or host interaction?

While E. tasmaniensis itself is not a plant pathogen but rather an epiphytic bacterium, its bifunctional protein aas(aas) contributes to host interactions in several important ways:

Cell Membrane Integrity:

The aas(aas) protein maintains phospholipid homeostasis, which is critical for membrane integrity during environmental stress conditions encountered on plant surfaces. This aids E. tasmaniensis in persisting as an epiphyte on healthy apple and pear trees .

Competitive Advantage:

Unlike pathogenic Erwinia species such as E. amylovora, E. tasmaniensis appears to use its membrane properties to establish itself on plant surfaces without causing disease. The bifunctional protein aas may contribute to this ecological adaptation.

Biocontrol Properties:

E. tasmaniensis can reduce symptom formation by the fire blight pathogen E. amylovora on immature pears and can inhibit colonization of apple flowers. The membrane composition, influenced by aas(aas), may play a role in this antagonistic activity .

E. tasmaniensis induces a hypersensitive response in tobacco leaves and synthesizes levan in the presence of sucrose, unlike some related epiphytic bacteria like E. billingiae. These characteristics, potentially linked to membrane properties maintained by aas(aas), contribute to its environmental fitness and biocontrol potential .

What experimental controls should be included when characterizing the enzymatic activity of Erwinia tasmaniensis Bifunctional protein aas(aas)?

A robust experimental design for characterizing aas(aas) enzymatic activity should include these essential controls:

Negative Controls:

  • Buffer-only reaction (no enzyme) to establish baseline measurements

  • Heat-denatured enzyme (95°C for 10 minutes) to confirm activity is enzyme-dependent

  • Single-domain mutants with inactivated catalytic sites to distinguish activities

  • Reactions with non-hydrolyzable substrate analogs to confirm substrate specificity

Positive Controls:

  • Well-characterized acyltransferases from E. coli or other model organisms

  • Previously validated batch of E. tasmaniensis aas(aas) protein

  • Standard phospholipid modification reactions with known outcomes

Condition Controls:

  • pH range (5.0-9.0) to determine optimal reaction conditions

  • Temperature series (4°C-50°C) to establish thermal properties

  • Metal ion dependency (EDTA chelation followed by specific ion addition)

  • Time course measurements to ensure linearity of reaction

Data Validation:

  • Multiple detection methods (spectrophotometric, chromatographic, mass spectrometric)

  • Technical replicates (minimum n=3) for statistical validity

  • Biological replicates with independent protein preparations (minimum n=3)

This comprehensive control strategy ensures that observed activities are specifically attributable to the bifunctional protein aas(aas) and provides robust characterization of its enzymatic properties.

How does Erwinia tasmaniensis Bifunctional protein aas(aas) contribute to bacterial membrane homeostasis?

The bifunctional protein aas(aas) plays a central role in membrane phospholipid remodeling through a coordinated cycle of reactions:

Membrane Lipid Recycling Pathway:

  • Detection and removal of damaged phospholipids from the membrane

  • Hydrolysis of acyl chains from damaged phospholipids

  • Transfer of new acyl groups to lysophospholipid intermediates

  • Reincorporation of remodeled phospholipids into the membrane

Specific Functions in Membrane Homeostasis:

  • Maintains proper membrane fluidity under changing environmental conditions

  • Repairs oxidative damage to membrane phospholipids

  • Adjusts fatty acid composition based on environmental stresses

  • Recycles fatty acids to conserve metabolic resources

The coordinated action of the two domains allows for efficient "membrane editing" without releasing potentially toxic lysophospholipid intermediates. This process is particularly important for epiphytic bacteria like E. tasmaniensis that must adapt to fluctuating environmental conditions on plant surfaces, including temperature changes, osmotic stress, and UV exposure .

The stable membrane composition maintained by aas(aas) likely contributes to E. tasmaniensis' ability to antagonize the fire blight pathogen E. amylovora on plant surfaces through competitive colonization.

What are the methodological approaches for troubleshooting expression and purification issues with Erwinia tasmaniensis Bifunctional protein aas(aas)?

When encountering difficulties with expression or purification, researchers should systematically address potential issues using this troubleshooting workflow:

Expression Issues:

  • Low/No Expression:

    • Verify plasmid sequence integrity

    • Test multiple E. coli strains (BL21, Rosetta, Origami)

    • Optimize induction conditions (temperature 18-25°C, IPTG 0.1-0.5 mM)

    • Consider codon optimization for E. coli expression

  • Inclusion Body Formation:

    • Reduce induction temperature to 16°C

    • Decrease IPTG concentration to 0.1 mM

    • Co-express with chaperones (GroEL/ES, DnaK)

    • Test fusion tags that enhance solubility (MBP, SUMO)

Purification Issues:

  • Poor Binding to Affinity Resin:

    • Verify tag accessibility (N-terminal vs. C-terminal)

    • Adjust lysis conditions to ensure complete solubilization

    • Test different detergents for membrane-associated fractions

    • Check pH and salt conditions of binding buffer

  • Protein Degradation:

    • Add protease inhibitors to all buffers

    • Reduce purification time and temperature

    • Verify protein identity by mass spectrometry

    • Perform Western blot to track degradation products

Activity Loss:

  • Establish baseline activity immediately after purification

  • Test stability in various buffer conditions

  • Add stabilizing agents (glycerol, trehalose, reducing agents)

  • Avoid freeze-thaw cycles by preparing single-use aliquots

This systematic approach allows researchers to identify and address specific issues affecting the production of functional E. tasmaniensis Bifunctional protein aas(aas).

How can researchers design experiments to investigate the physiological role of Erwinia tasmaniensis Bifunctional protein aas(aas) in vivo?

To elucidate the physiological role of aas(aas) in E. tasmaniensis, researchers should implement a multi-faceted experimental approach:

Genetic Manipulation Strategies:

  • Gene Knockout/Knockdown:

    • Create a clean deletion mutant using homologous recombination

    • Implement CRISPR-Cas9 system for precise gene editing

    • Design inducible antisense RNA constructs for conditional knockdown

  • Complementation Studies:

    • Reintroduce wild-type gene to confirm phenotype rescue

    • Express individual domains separately to assess their contributions

    • Create point mutations in catalytic sites to distinguish domain functions

Phenotypic Characterization:

  • Membrane Composition Analysis:

    • Lipidomic profiling using mass spectrometry

    • Phospholipid turnover rates using isotope labeling

    • Membrane fluidity assessment using fluorescent probes

  • Stress Response Evaluation:

    • Growth curves under various environmental stressors

    • Temperature sensitivity profiling (4-42°C)

    • Osmotic stress tolerance testing

    • Oxidative stress challenge with H₂O₂ or paraquat

  • Plant Interaction Studies:

    • Colonization efficiency on apple and pear leaf surfaces

    • Competition assays with E. amylovora on plant tissues

    • Biofilm formation capacity on plant-derived materials

    • Hypersensitive response induction in tobacco leaves

These methodologies would provide comprehensive insights into how aas(aas) contributes to E. tasmaniensis fitness, particularly in its epiphytic lifestyle and potential biocontrol applications.

How does the genomic context of the aas gene in Erwinia tasmaniensis compare to related species, and what insights does this provide?

Comparative genomic analysis reveals important evolutionary and functional relationships:

Genomic Organization:

In E. tasmaniensis strain Et1/99, the aas gene (ETA_27680) exists within a conserved genomic region containing genes involved in phospholipid metabolism and membrane biogenesis. This organization differs slightly from pathogenic Erwinia species.

Comparative Analysis:

SpeciesGene IDGenomic ContextNotable Differences
E. tasmaniensis Et1/99ETA_27680Phospholipid metabolism clusterComplete bifunctional gene
E. amylovoraEAMY_2765Similar arrangementAssociated with virulence genes
E. pyrifoliaeEPY_2883Similar arrangementAssociated with virulence genes
E. billingiaeEbC_31850Divergent arrangementDifferent regulatory elements

Evolutionary Insights:

The aas gene is conserved across Erwinia species but shows variations in genome neighborhood that correlate with pathogenic versus non-pathogenic lifestyles. Pathogenic species like E. amylovora and E. pyrifoliae show integration of membrane-related genes with virulence clusters, while epiphytic species like E. tasmaniensis maintain these functions separately .

This genomic organization likely reflects adaptation to different ecological niches - epiphytic survival for E. tasmaniensis versus pathogenic invasion for E. amylovora. The bifunctional aas protein shows evolutionary conservation of function while its regulatory context has diverged to support different bacterial lifestyles on plant surfaces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.