Recombinant Erwinia tasmaniensis Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; ETA_15900; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
clsA
Target Protein Sequence
MTTFYTVMSWLLVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSLGE LHLGKRRAERARTMWPSTARWLNDLKSSHHIFAKENSDVAQALFQLCEKRQGIAGVKGNQ LQLLTSTDETLSTLVRDIELARHNIEMVFYIWQPGGHADDVAEALMAAARRGVHCRLLLD SAGSVTFFRSPWPAMMRNAGVDVVEALRVSLLRVFLRRMDLRQHRKVVLIDNYIAYTGSM NLVDPRFFKQNAGVGQWVDLMARMEGPVATTMGIIYSCDWEIETGRRILPPPPDDNVMPF EQESGHTIQVIASGPGFPEDMIHQALLTAVYSAREQLIMTTPYLVPSDDLLHAICTAAYR GVEVSIIVPRHIDSMLVRWASRAFFGELLAAGVKIYQFEGGLLHSKSILVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGSDLARVQEDYIARSRLVDAKRWAHRAYWQRIVERLFY FFSPLL
Uniprot No.

Target Background

Function

Recombinant Erwinia tasmaniensis Cardiolipin Synthase (Cls) catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, forming cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia tasmaniensis cardiolipin synthase and what is its role in cellular metabolism?

Erwinia tasmaniensis cardiolipin synthase (cls) is an enzyme that catalyzes the final step in cardiolipin synthesis, transferring a phosphatidyl group to phosphatidylglycerol to form cardiolipin, the signature phospholipid of bacterial membranes and mitochondrial inner membranes in eukaryotes. In bacteria like E. tasmaniensis, cardiolipin is essential for membrane stability, particularly under stress conditions. The enzyme is encoded by the cls or clsA gene (previously denoted as ETA_15900 in E. tasmaniensis) and functions as part of the phospholipid biosynthetic pathway . Cardiolipin plays crucial roles in membrane curvature, cristae formation, and protein-lipid interactions that are essential for proper respiratory chain function and energy metabolism .

How does E. tasmaniensis cls differ from cardiolipin synthases in other organisms?

While the core catalytic mechanism of cardiolipin synthases is conserved across species, there are notable differences between bacterial and eukaryotic versions. In prokaryotes like E. tasmaniensis, cardiolipin formation involves the condensation of two phosphatidylglycerol molecules, whereas in eukaryotes, cardiolipin synthase uses phosphatidylglycerol and CDP-diacylglycerol as substrates . Phylogenetic analysis positions E. tasmaniensis cls within the Erwinia genus, sharing common ancestry with both pathogenic species (E. amylovora, E. pyrifoliae) and non-pathogenic species . Additionally, bacterial cardiolipin synthases like that from E. tasmaniensis have been found to respond to osmotic stress, with transcription levels increasing 2-3 fold under high osmolality conditions .

What are the optimal conditions for expression and purification of recombinant E. tasmaniensis cardiolipin synthase?

For optimal expression of recombinant E. tasmaniensis cardiolipin synthase, the full-length protein (1-486 amino acids) can be expressed with an N-terminal His-tag in E. coli expression systems . The protein is typically produced as a membrane-associated protein, necessitating appropriate solubilization methods during purification. After expression, the protein should be purified using affinity chromatography (Ni-NTA for His-tagged protein), followed by additional purification steps if higher purity is required .

For storage, the purified protein is best maintained as a lyophilized powder or in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . To prevent activity loss from repeated freeze-thaw cycles, it's recommended to store working aliquots at 4°C for up to one week and long-term storage at -20°C/-80°C . When reconstituting the protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (typically 50% final concentration) for long-term storage stability .

How can I design experiments to assess the enzymatic activity of recombinant E. tasmaniensis cardiolipin synthase?

To assess the enzymatic activity of recombinant E. tasmaniensis cardiolipin synthase, researchers should design experiments that measure the conversion of phosphatidylglycerol to cardiolipin. Based on characterization studies of cardiolipin synthases, the following methodological approach is recommended:

  • Substrate preparation: Prepare phosphatidylglycerol (PG) as the substrate. For bacterial cardiolipin synthases like E. tasmaniensis cls, two PG molecules are required for the condensation reaction .

  • Reaction conditions: Based on studies of other cardiolipin synthases, the enzyme typically has an alkaline pH optimum and requires divalent cations (such as Mg²⁺) for activity .

  • Activity assay: The enzyme activity can be measured by monitoring:

    • Consumption of PG using thin-layer chromatography (TLC) or HPLC

    • Formation of cardiolipin using mass spectrometry

    • Release of inorganic phosphate as a reaction byproduct using colorimetric assays

  • Specificity analysis: Test different CDP-diacylglycerol species as potential substrates to determine if E. tasmaniensis cls exhibits substrate preferences similar to other characterized cardiolipin synthases .

  • Variables to control: Temperature, pH, ionic strength, and divalent cation concentration should be systematically varied to determine optimal reaction conditions.

For validation of activity, complementation studies in cardiolipin synthase-deficient organisms (such as yeast crd1Δ mutants) can be performed to confirm functional activity of the recombinant enzyme .

What experimental controls should be included when studying recombinant E. tasmaniensis cardiolipin synthase function?

When designing experiments to study recombinant E. tasmaniensis cardiolipin synthase function, several critical controls should be included:

  • Negative enzyme control: Heat-inactivated enzyme preparation to establish baseline non-enzymatic reaction rates.

  • Substrate controls: Reactions without phosphatidylglycerol or with structurally similar phospholipids to confirm substrate specificity.

  • Cofactor controls: Reactions without divalent cations or with chelating agents (EDTA) to verify cofactor requirements.

  • Positive control: If available, a well-characterized cardiolipin synthase (such as from E. coli) to benchmark activity levels.

  • Genetic complementation controls: When performing in vivo studies:

    • Empty vector control in cls-deficient strains

    • Wild-type cls gene for comparison with the recombinant version

    • Site-directed mutants of conserved catalytic residues to confirm structure-function relationships

  • Environmental condition controls: When studying stress responses, appropriate osmotic and pH controls should be included to verify transcriptional or activity changes under different environmental conditions .

For proper experimental design, researchers should implement a factorial approach that systematically varies key parameters (temperature, pH, substrate concentration) to determine optimal conditions and kinetic parameters of the enzyme .

How can researchers assess the role of E. tasmaniensis cardiolipin synthase in membrane function?

To comprehensively assess the role of E. tasmaniensis cardiolipin synthase in membrane function, researchers should employ a multi-faceted approach:

  • Genetic knockout/knockdown studies:

    • Create conditional cls knockout strains using CRISPR-Cas9 or homologous recombination techniques

    • Implement inducible expression systems to control cls expression levels

    • Monitor changes in growth, morphology, and stress responses in cls-deficient strains

  • Membrane integrity and function assessment:

    • Measure membrane potential using fluorescent dyes (e.g., DiOC₆)

    • Analyze membrane fluidity using anisotropy measurements

    • Examine lipid distribution and microdomain formation using fluorescently-labeled lipid probes

  • Lipidomic analysis:

    • Quantify changes in cardiolipin content and composition using mass spectrometry

    • Profile shifts in other phospholipid species that may compensate for cardiolipin deficiency

    • Analyze acyl chain remodeling patterns in response to stress conditions

  • Protein-lipid interaction studies:

    • Identify membrane proteins that interact with cardiolipin using crosslinking or co-immunoprecipitation

    • Assess respiratory chain complex assembly and stability using blue-native gel electrophoresis

    • Evaluate the formation and stability of supercomplexes dependent on cardiolipin

  • Stress response analysis:

    • Challenge cells with osmotic stress, oxidative stress, or temperature shifts

    • Monitor cls transcription and cardiolipin synthesis rates under stress conditions

    • Quantify survival rates and membrane integrity during stress exposure

This integrated approach will provide comprehensive insights into how E. tasmaniensis cardiolipin synthase contributes to membrane homeostasis and cellular function.

What are the methodological approaches to study the influence of osmotic stress on E. tasmaniensis cardiolipin synthase expression?

To investigate the influence of osmotic stress on E. tasmaniensis cardiolipin synthase expression, researchers should employ the following methodological approaches:

  • Transcriptional analysis:

    • Construct cls-reporter gene fusions (such as cls-lacZ) to quantitatively monitor transcriptional responses

    • Perform quantitative RT-PCR to measure cls mRNA levels under varying osmotic conditions

    • Use RNA-seq to analyze global transcriptional changes, positioning cls regulation within the broader stress response network

  • Osmotic stress conditions:

    • Apply defined osmotic stresses using NaCl, sucrose, or other osmolytes at various concentrations

    • Implement both acute shock and gradual adaptation protocols to distinguish immediate from adaptive responses

    • Monitor osmotic pressure using appropriate osmometers to ensure precise stress application

  • Protein expression analysis:

    • Generate antibodies against E. tasmaniensis cls or use epitope-tagged versions for immunodetection

    • Perform Western blotting to quantify cls protein levels under different osmotic conditions

    • Implement pulse-chase experiments to determine protein stability and turnover rates

  • Enzymatic activity measurements:

    • Isolate membranes from osmotically stressed cells to measure native cls activity

    • Compare in vitro activity of the enzyme under varying ionic strengths to mimic osmotic stress

    • Correlate changes in cls activity with alterations in cellular cardiolipin content

  • Genetic approaches:

    • Identify potential osmotic stress response elements in the cls promoter region

    • Perform promoter deletion/mutation analysis to map osmotic stress-responsive elements

    • Test cls expression in mutants defective in known osmotic stress response pathways

Research has shown that osmotic stress can induce a 2- to 3-fold increase in cls transcription in bacteria, making this a particularly relevant area for investigation when studying E. tasmaniensis cardiolipin synthase .

How can researchers investigate the role of cardiolipin in E. tasmaniensis under different environmental conditions?

To investigate the role of cardiolipin in E. tasmaniensis under different environmental conditions, researchers should implement a comprehensive experimental framework:

  • Environmental stress exposure:

    • Temperature stress: Expose cultures to heat shock (42-45°C) and cold shock (4-15°C)

    • pH stress: Challenge bacteria with acidic (pH 4-5) and alkaline (pH 8-9) conditions

    • Oxidative stress: Apply H₂O₂, paraquat, or other ROS-generating compounds

    • Osmotic stress: Test hyper-osmotic (high salt/sugar) and hypo-osmotic conditions

    • Nutrient limitation: Study cardiolipin dynamics during stationary phase or nutrient deprivation

  • Cardiolipin quantification:

    • Extract total lipids using Bligh-Dyer or similar methods

    • Separate phospholipids by thin-layer chromatography or liquid chromatography

    • Quantify cardiolipin levels using phosphorus assays or mass spectrometry

    • Analyze cardiolipin fatty acid composition and remodeling patterns

  • Membrane property assessment:

    • Measure membrane fluidity using fluorescence anisotropy or electron paramagnetic resonance

    • Analyze membrane permeability using fluorescent dyes or ion leakage assays

    • Examine membrane potential and proton gradient maintenance

  • Functional studies:

    • Assess growth rates and survival under stress conditions in wild-type vs. cls mutants

    • Measure respiratory chain function and ATP synthesis capacity

    • Analyze protein complex stability and supercomplex formation

    • Monitor cell division and morphological changes

  • Genetic complementation:

    • Test whether wild-type cls expression can restore stress tolerance in cls-deficient strains

    • Introduce cls variants with altered activity or regulation to determine structure-function relationships

    • Express heterologous cls genes from different organisms to assess functional conservation

This systematic approach will provide insights into how cardiolipin contributes to E. tasmaniensis adaptation to various environmental challenges, particularly given the observed induction of cls transcription under osmotic stress and stationary phase conditions .

How do researchers compare functional differences between bacterial and eukaryotic cardiolipin synthases in experimental settings?

To effectively compare bacterial (like E. tasmaniensis) and eukaryotic cardiolipin synthases, researchers should employ a multi-dimensional comparative approach:

  • Biochemical characterization:

    • Substrate specificity: Test both enzyme types with various phospholipid substrates to confirm that bacterial CLS uses two phosphatidylglycerol molecules, while eukaryotic CLS uses phosphatidylglycerol and CDP-diacylglycerol

    • Kinetic parameters: Determine and compare Km, Vmax, and catalytic efficiency

    • pH optima: Establish pH activity profiles for both enzyme types

    • Cofactor requirements: Compare divalent cation preferences and concentration optima

  • Structural analysis:

    • Sequence alignment: Identify conserved motifs and divergent regions

    • Homology modeling: Create structural models to visualize differences in substrate binding sites

    • Domain organization: Compare arrangement of transmembrane vs. catalytic domains

  • Genetic complementation studies:

    • Express bacterial cls in eukaryotic cls-deficient cells (e.g., yeast crd1Δ mutants)

    • Express eukaryotic CLS in bacterial cls knockouts

    • Quantify the degree of functional complementation by measuring cardiolipin levels and phenotypic rescue

  • Evolutionary analysis:

    • Construct phylogenetic trees of CLS proteins from diverse organisms

    • Identify key amino acid substitutions that differentiate bacterial from eukaryotic enzymes

    • Perform ancestral sequence reconstruction to identify evolutionary transitions

  • Localization and membrane integration:

    • Compare subcellular localization (bacterial membrane vs. mitochondrial inner membrane)

    • Analyze membrane topology using protease protection assays

    • Examine protein-protein interactions with other membrane components

This comparative approach will help elucidate the functional divergence between bacterial and eukaryotic cardiolipin synthases, which is particularly relevant given the discovery of bacterial-type cardiolipin synthases in some eukaryotes like Trypanosoma brucei, suggesting a complex evolutionary history of this enzyme family .

What approaches can be used to study the evolutionary relationship between E. tasmaniensis cardiolipin synthase and other bacterial cardiolipin synthases?

To study the evolutionary relationships between E. tasmaniensis cardiolipin synthase and other bacterial cardiolipin synthases, researchers should implement the following approaches:

  • Phylogenetic analysis:

    • Construct multiple sequence alignments of cls sequences from diverse bacterial species

    • Build phylogenetic trees using maximum likelihood, Bayesian inference, and neighbor-joining methods

    • Perform bootstrap analysis to assess the statistical support for evolutionary relationships

    • Compare phylogenies based on cls genes with those based on core genome sequences to identify potential horizontal gene transfer events

  • Comparative genomics:

    • Analyze cls gene neighborhoods across bacterial species to identify conserved synteny or genomic rearrangements

    • Examine G+C content and codon usage patterns to detect signs of recent gene acquisition

    • Map the presence/absence of cls genes across the bacterial phylogeny

    • Identify paralogous cls genes within genomes (such as clsA, clsB, and clsC in some bacteria)

  • Molecular evolution analyses:

    • Calculate sequence conservation scores for different domains and motifs

    • Identify sites under positive or purifying selection using dN/dS ratio analysis

    • Perform evolutionary rate covariation analysis to detect co-evolving residues

    • Use ancestral sequence reconstruction to infer evolutionary trajectories

  • Structure-function relationship studies:

    • Map conserved and variable regions onto structural models

    • Identify catalytic residues that are invariant across bacterial species

    • Compare substrate binding pockets to understand specificity differences

    • Analyze conserved protein-protein interaction interfaces

  • Experimental validation:

    • Test the function of reconstructed ancestral cls sequences

    • Generate chimeric enzymes between E. tasmaniensis cls and other bacterial cls to map functional domains

    • Perform site-directed mutagenesis of conserved residues to validate their roles

    • Express cls genes from different bacterial lineages in a common host to compare functional properties

Phylogenetic studies have shown that E. tasmaniensis clusters within the Erwinia genus, sharing common ancestry with both pathogenic and non-pathogenic Erwinia species, which provides context for understanding the evolution of cardiolipin synthase within this bacterial group .

How can researchers identify and characterize conserved motifs in cardiolipin synthases that determine substrate specificity?

To identify and characterize conserved motifs in cardiolipin synthases that determine substrate specificity, researchers should employ a comprehensive structure-function analysis approach:

  • Sequence-based analysis:

    • Perform multiple sequence alignments of diverse cardiolipin synthases and related enzymes like phosphatidylglycerophosphate synthases

    • Identify conserved motifs specific to cardiolipin synthases, such as the core CDP-OH-P motif D(X)2DG(X)2AR(X)8-9G(X)3D(X)3D

    • Compare bacterial and eukaryotic cardiolipin synthases to identify class-specific sequence signatures

    • Look for differences in residues surrounding the catalytic site that might influence substrate binding

  • Structural biology approaches:

    • Generate homology models based on crystal structures of related enzymes

    • Perform molecular docking simulations with different substrates

    • Use molecular dynamics simulations to analyze substrate-enzyme interactions

    • If possible, determine X-ray crystal or cryo-EM structures of the enzyme with bound substrates or substrate analogs

  • Site-directed mutagenesis:

    • Systematically mutate conserved residues within and around identified motifs

    • Generate chimeric enzymes swapping domains between cardiolipin synthases with different specificities

    • Create cls variants with altered motifs that mimic those found in PGPSs (e.g., introducing the FxxAxxT motif found in PGPSs but not in CLSs)

  • Enzymatic characterization:

    • Measure kinetic parameters (Km, kcat, specificity constant) for wild-type and mutant enzymes

    • Test substrate specificity using structurally diverse phospholipid substrates

    • Analyze the effects of mutations on pH optima and cofactor requirements

    • Determine the impact of mutations on product distribution

  • In vivo validation:

    • Express mutant enzymes in cls-deficient strains to assess functional complementation

    • Analyze the lipid composition of membranes in cells expressing wild-type versus mutant enzymes

    • Examine phenotypic effects of expressing enzymes with altered specificity

Research has identified several conserved motifs that may differentiate cardiolipin synthases from other phospholipid biosynthetic enzymes, including the absence of an FxxAxxT motif immediately before the core CDP-OH-P motif that is present in phosphatidylglycerophosphate synthases .

How can researchers design experiments to investigate the role of E. tasmaniensis cardiolipin synthase in bacterial stress responses?

To comprehensively investigate the role of E. tasmaniensis cardiolipin synthase in bacterial stress responses, researchers should design experiments with the following methodological framework:

  • Genetic manipulation strategies:

    • Generate cls knockout mutants using targeted gene deletion techniques

    • Create conditional expression systems using inducible promoters to control cls expression levels

    • Develop cls reporter constructs (cls-GFP fusion) to monitor localization and expression dynamics

    • Introduce site-specific mutations in regulatory regions to alter stress responsiveness

  • Stress challenge experimental design:

    • Apply multiple stressors: osmotic, oxidative, temperature, pH, and nutrient limitation

    • Design time-course experiments to distinguish immediate from adaptive responses

    • Implement both acute and chronic stress paradigms

    • Use factorial experimental designs to test for interactions between different stressors

  • Multi-omics analytical approach:

    • Transcriptomics: RNA-seq to analyze global transcriptional responses to stress in wild-type vs. cls mutants

    • Proteomics: Quantitative mass spectrometry to identify protein changes in response to stress

    • Lipidomics: Comprehensive lipid profiling to monitor changes in membrane composition

    • Metabolomics: Analysis of metabolic shifts that may compensate for altered membrane properties

  • Functional assessments:

    • Growth and survival assays under various stress conditions

    • Membrane integrity measurements using fluorescent dyes or electrophysiology

    • Respirometry to assess electron transport chain function

    • ATP synthesis capacity and energy charge determination

  • Molecular interaction studies:

    • Identify stress-responsive transcription factors that regulate cls expression

    • Map protein-protein interactions of cls under different stress conditions

    • Characterize changes in membrane protein complexes dependent on cardiolipin

    • Examine potential regulatory post-translational modifications of cls

This comprehensive experimental approach will enable researchers to delineate the specific roles of E. tasmaniensis cardiolipin synthase in stress adaptation, building on existing knowledge that cls transcription increases 2-3 fold under osmotic stress and during stationary phase .

What are the methodological considerations when designing experiments to study cardiolipin synthase membrane topology and integration?

When designing experiments to study cardiolipin synthase membrane topology and integration in E. tasmaniensis, researchers should consider the following methodological approaches:

  • Computational prediction and modeling:

    • Use transmembrane prediction algorithms (TMHMM, TOPCONS, Phobius) to identify potential membrane-spanning regions

    • Perform hydropathy analysis to map hydrophobic domains

    • Generate topology models predicting the orientation of N- and C-termini and loop regions

    • Create 3D structural models incorporating membrane environments

  • Reporter fusion approaches:

    • Construct translational fusions with topology reporter proteins (PhoA, LacZ, GFP) at various positions

    • PhoA is active when located in the periplasm, while LacZ functions in the cytoplasm

    • Measure reporter activity to determine the cellular location of each fusion point

    • Generate a series of truncations with C-terminal reporters to map topology comprehensively

  • Cysteine scanning mutagenesis:

    • Introduce cysteine residues at various positions throughout the protein

    • Assess accessibility to membrane-impermeable sulfhydryl reagents

    • Determine which cysteines are accessible from which side of the membrane

    • Use crosslinking agents to identify proximity relationships between domains

  • Protease protection assays:

    • Prepare inside-out and right-side-out membrane vesicles

    • Treat with proteases and identify protected fragments by immunoblotting

    • Map cleavage sites to determine which regions are accessible to proteases

    • Use antibodies against different domains to identify protected fragments

  • Advanced microscopy techniques:

    • Implement super-resolution microscopy with domain-specific fluorescent tags

    • Use FRET pairs to measure proximity between domains

    • Apply single-molecule tracking to analyze dynamics of membrane integration

    • Perform correlative light and electron microscopy to visualize membrane integration

  • Genetic and biochemical validation:

    • Create chimeric constructs swapping transmembrane domains with those of proteins with known topology

    • Test the functional impact of altering transmembrane domains on enzyme activity

    • Examine the importance of specific transmembrane regions through mutagenesis

Research has shown that the transmembrane domains of cardiolipin synthase are critical for proper orientation of the catalytic domain and enzyme function, as demonstrated by experiments with chimeric constructs .

How can advanced imaging techniques be applied to study the localization and dynamics of E. tasmaniensis cardiolipin synthase?

To study the localization and dynamics of E. tasmaniensis cardiolipin synthase with advanced imaging techniques, researchers should implement the following methodological approaches:

  • Fluorescent protein tagging strategies:

    • Generate C- or N-terminal fusions with fluorescent proteins (GFP, mCherry, mScarlet)

    • Create internal fluorescent protein insertions at permissive sites

    • Implement split-GFP complementation to detect protein-protein interactions

    • Use photoactivatable or photoconvertible fluorescent proteins for pulse-chase imaging

  • Super-resolution microscopy techniques:

    • Apply Stimulated Emission Depletion (STED) microscopy for sub-diffraction imaging

    • Implement Single-Molecule Localization Microscopy (PALM/STORM) for nanoscale localization

    • Use Structured Illumination Microscopy (SIM) for improved resolution of membrane structures

    • Combine with expansion microscopy for physical magnification of subcellular structures

  • Live-cell dynamics analysis:

    • Perform Fluorescence Recovery After Photobleaching (FRAP) to measure lateral mobility

    • Use Fluorescence Correlation Spectroscopy (FCS) to analyze diffusion characteristics

    • Implement single-particle tracking to follow individual molecules

    • Apply Fluorescence Lifetime Imaging Microscopy (FLIM) to detect environmental changes

  • Colocalization studies:

    • Simultaneously image cls with markers for different membrane domains

    • Perform quantitative colocalization analysis using Pearson's or Mander's coefficients

    • Use spectral unmixing for multiple fluorophore detection

    • Implement proximity ligation assays to detect closely associated proteins

  • Correlative microscopy approaches:

    • Combine fluorescence microscopy with electron microscopy (CLEM)

    • Use cryo-electron tomography to visualize membrane protein complexes

    • Apply focused ion beam-scanning electron microscopy (FIB-SEM) for 3D ultrastructural analysis

    • Implement expansion microscopy combined with super-resolution techniques

  • Functional imaging:

    • Use lipid-specific probes to visualize cardiolipin distribution concurrently with cls

    • Apply voltage-sensitive dyes to correlate cls localization with membrane potential

    • Implement calcium or pH indicators to link cls dynamics with cellular physiology

    • Use FRET-based activity sensors to monitor cls enzymatic function in situ

Previous research has shown that cardiolipin synthase colocalizes with inner mitochondrial membrane proteins and forms part of large protein complexes, suggesting that spatial organization is important for its function . Similar approaches can be applied to study the bacterial enzyme's localization and dynamics in E. tasmaniensis.

Table: Key Methodological Approaches for Studying E. tasmaniensis Cardiolipin Synthase

Research FocusTechniquesKey Parameters to MeasureControls Required
Protein ExpressionRecombinant E. coli systems, Yeast expressionProtein yield, Solubility, Activity retentionEmpty vector, Wild-type cls, Tagged standard proteins
Enzymatic ActivityIn vitro biochemical assays, Radiometric assays, HPLCReaction rate, Substrate specificity, Kinetic parametersHeat-inactivated enzyme, No-substrate, No-cofactor
Membrane IntegrationReporter fusions, Cysteine scanning, Protease protectionTopology mapping, TM domain identificationKnown topology proteins, Inside-out vs. right-side-out vesicles
Stress ResponseqRT-PCR, Western blotting, LipidomicsTranscription levels, Protein amounts, Lipid compositionHousekeeping genes, Non-stress conditions, Time-matched controls
Functional AnalysisKnockout/complementation, Site-directed mutagenesisGrowth rates, Membrane integrity, Stress survivalWild-type strain, Vector-only, Point mutants of key residues
Evolutionary StudiesPhylogenetics, Comparative genomicsSequence conservation, Selection pressure, Taxonomic distributionMultiple algorithms, Random sequence simulations
Localization StudiesFluorescence microscopy, Super-resolution, FRETSubcellular distribution, Protein-protein interactionsMembrane markers, Free fluorophores, Untransfected cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.