Recombinant Erwinia tasmaniensis Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
rnfG; ETA_17780; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
rnfG
Target Protein Sequence
MLDAIRKNGVTLAVFAAITTGLTAVINAVTKPTIEHQTAVQQKILLDQVVPPELYNNRIQ DECYSVTDPALGNTNPHHLYLARKDDKPVAVALETTAPDGYSGNIQMIVGASFDGIVYGT RVVEHHETPGLGDKIELRISDWINSFNGKKVNGPSDGHFAVKKDGGDFDQFTGATITPRA VVNAVKRTTLYIETLPGQLSSLPTCGDANE
Uniprot No.

Target Background

Function
A component of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is RnfG and what role does it play in bacterial energy metabolism?

RnfG is a protein subunit of the Rnf complex, which is a membrane-bound enzyme found in many bacteria. The Rnf complex (Rhodobacter nitrogen fixation) plays a critical role in energy conservation and electron transport in these organisms. Specifically, it functions as a ferredoxin:NAD+ oxidoreductase, catalyzing the oxidation of reduced ferredoxin and the reduction of NAD+ (or vice versa), coupled to ion transport across the cytoplasmic membrane . In Erwinia tasmaniensis, RnfG is a 210 amino acid protein that contains FMN (flavin mononucleotide) as a cofactor, which is essential for its electron transfer function .

The Rnf complex, including RnfG, is particularly important in anaerobic bacteria, where it can function in both directions: either generating a sodium ion gradient to drive ATP synthesis during ferredoxin oxidation, or using the sodium ion gradient to drive the energetically unfavorable reduction of ferredoxin with NADH as an electron donor .

How does the Rnf complex function as a Na+ coupled respiratory enzyme?

The Rnf complex functions as a primary Na+ pump, coupling electron transfer with the translocation of Na+ ions across the membrane. Research on the Rnf complex from Thermotoga maritima has provided direct evidence of this Na+ pumping activity . The complex oxidizes reduced ferredoxin (Fdred) and transfers the electrons to NAD+, forming NADH. This electron transfer is coupled to the translocation of Na+ ions from the cytoplasm to the periplasm, generating a sodium ion gradient across the membrane.

The specific mechanism involves electron flow from ferredoxin to NAD+ through several protein subunits:

  • RnfB: Entry point for electrons from reduced ferredoxin

  • RnfA and RnfG: Intermediate electron carriers

  • RnfC: NAD+ binding site

  • RnfD and RnfE: Membrane-integral subunits that mediate Na+ transport

In T. maritima, this Na+ gradient can then be utilized by a Na+-F1FO ATP synthase to generate ATP, forming a simple, two-limb respiratory chain .

What is the taxonomic distribution of RnfG among bacterial species?

Erwinia tasmaniensis, a member of the Erwiniaceae family within the order Enterobacterales and class Gammaproteobacteria, contains the rnfG gene (designated as ETA_17780) in its genome . The Rnf complex has also been studied in other bacterial species, including:

  • Acetobacterium woodii (an acetogen)

  • Thermotoga maritima (a thermophilic, anaerobic fermenting bacterium)

  • Methanosarcina acetivorans (an acetate-utilizing methane-producing archaeon)

This wide distribution across different bacterial taxa, and even extending to some archaea, suggests that the Rnf complex plays a fundamental role in the energy metabolism of diverse prokaryotic organisms, particularly those that live in anaerobic environments .

How does the FMN cofactor in RnfG participate in electron transfer?

The FMN (flavin mononucleotide) cofactor in RnfG plays a central role in the electron transfer processes of the Rnf complex. As a redox-active molecule, FMN can accept and donate electrons, making it an ideal mediator in electron transport chains.

Experimental characterization of RnfG from Methanosarcina acetivorans revealed that:

  • The purified RnfG subunit fluoresced in SDS-PAGE gels under UV illumination and showed a UV-visible spectrum typical of flavoproteins

  • A Thr166Gly variant of RnfG was colorless and failed to fluoresce under UV illumination, confirming the role of Thr166 in binding FMN

  • Redox titration of holo-RnfG revealed a midpoint potential of -129 mV for FMN with n = 2, indicating a two-electron transfer process

This midpoint potential positions FMN appropriately within the electron transfer chain of the Rnf complex, allowing it to accept electrons from upstream components (likely via RnfA) and pass them to downstream components, ultimately contributing to the reduction of NAD+ to NADH.

The specific electron transfer pathway in the Rnf complex is believed to start with RnfB accepting electrons from reduced ferredoxin. These electrons then flow through RnfA and RnfG (via its FMN cofactor) to RnfC, which contains the NAD+ binding site .

What is the membrane topology of RnfG and how was it determined experimentally?

The membrane topology of RnfG has been experimentally determined through a combination of biochemical and genetic approaches. Studies on RnfG from Methanosarcina acetivorans provide insights into its membrane topology:

This topology is significant because it positions the FMN-containing domain of RnfG where it can participate in electron transfer with other components of the Rnf complex. The experimental approach used represents a powerful combination of genetic engineering (reporter protein fusions) and computational methods (sequence-based predictions), illustrating the multi-faceted approach often required to elucidate the structural details of membrane proteins like RnfG.

What expression systems are most effective for producing recombinant RnfG protein?

Based on the available research data, E. coli has been successfully used as an expression system for producing recombinant RnfG protein. For instance, recombinant full-length Erwinia tasmaniensis Electron transport complex protein RnfG has been expressed in E. coli with an N-terminal His tag . Similarly, the RnfG subunit from Methanosarcina acetivorans was successfully overproduced in E. coli for characterization studies .

For optimal expression of recombinant proteins like RnfG, several factors should be considered:

  • Expression Vector Selection: The choice of expression vector impacts protein yield and quality. For RnfG, vectors that allow for control of expression levels may be beneficial since membrane proteins can sometimes be toxic when overexpressed.

  • E. coli Strain Selection: BL21(DE3) is a commonly used E. coli strain for recombinant protein expression, as mentioned in a related protocol for producing recombinant fluorescent proteins .

  • Induction Conditions: Optimizing parameters such as inducer concentration, induction temperature, and duration can significantly affect protein yield and solubility. Lower temperatures (e.g., 16-20°C) during induction can sometimes improve the folding of complex proteins like RnfG.

  • Tag Selection: For RnfG, an N-terminal His tag has been successfully employed . The location of the tag (N- or C-terminal) should be chosen carefully to avoid interfering with protein folding or function.

For membrane proteins like RnfG, additional considerations include:

  • Use of specialized E. coli strains optimized for membrane protein expression

  • Addition of membrane-solubilizing detergents during cell lysis and purification

  • Careful optimization of cell lysis conditions to efficiently extract membrane-associated proteins

What purification strategies yield the highest purity of functional RnfG?

Based on the research data, the following purification strategies have been employed for RnfG and similar proteins:

  • Immobilized Metal Affinity Chromatography (IMAC): For His-tagged RnfG, purification using Ni-NTA (nickel-nitrilotriacetic acid) columns is effective. This approach was mentioned in the protocol for recombinant fluorescent TAT-HA-tagged proteins and is likely applicable to His-tagged RnfG as well.

  • Buffer Optimization: The choice of purification buffers is critical. For RnfG, which contains an FMN cofactor, buffers that preserve the cofactor binding and protein stability should be selected. The storage buffer mentioned for recombinant E. tasmaniensis RnfG is a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

  • Protein Handling Protocol:

    • After purification, RnfG is typically stored as a lyophilized powder

    • For reconstitution, briefly centrifuge the vial prior to opening

    • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) and aliquot for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles, which can degrade the protein

  • Quality Assessment: The purity of RnfG can be assessed using SDS-PAGE, with greater than 90% purity typically achieved . For functional assessment, spectroscopic methods to detect the FMN cofactor (fluorescence under UV illumination and UV-visible spectroscopy) can be employed .

To ensure the isolation of functional RnfG with its FMN cofactor intact, careful attention should be paid to maintaining appropriate pH and ionic strength during purification and including stabilizing agents like glycerol or trehalose in buffers.

How can the redox properties of RnfG be experimentally determined?

The redox properties of RnfG, particularly those related to its FMN cofactor, can be experimentally determined using several complementary approaches:

  • Redox Titration: This technique was successfully applied to holo-RnfG from Methanosarcina acetivorans, revealing a midpoint potential of -129 mV for FMN with n = 2 . In a redox titration, the protein's redox state is systematically varied by adding oxidizing or reducing agents, and the spectroscopic properties are monitored to determine the midpoint potential at which the cofactor is half-reduced.

  • UV-Visible Spectroscopy: RnfG containing FMN shows characteristic absorption spectra that change depending on the redox state of the flavin:

    • Oxidized form: Absorption peaks around 370 and 450 nm

    • Reduced form: Diminished absorption in these regions

    Monitoring these spectral changes during redox titrations provides information about the redox properties of the FMN cofactor in RnfG .

  • Fluorescence Spectroscopy: FMN is fluorescent in its oxidized state but not in its reduced state. This property can be exploited to monitor the redox state of the cofactor in RnfG. As observed with M. acetivorans RnfG, the protein fluoresced in SDS-PAGE gels under UV illumination due to the presence of FMN .

  • Site-Directed Mutagenesis: Creating variants of RnfG with mutations in residues suspected to be involved in FMN binding or electron transfer can provide insights into the factors influencing its redox properties. This approach was demonstrated with the Thr166Gly variant of M. acetivorans RnfG, which failed to bind FMN .

These experimental approaches, either individually or in combination, can provide comprehensive information about the redox properties of RnfG, including the midpoint potential of its FMN cofactor, the number of electrons involved in the redox process, and the influence of protein environment on these properties.

What experimental design approaches are optimal for studying RnfG function?

Studying the function of RnfG requires a thoughtful experimental design approach to address specific research questions while overcoming the challenges associated with membrane-associated proteins involved in electron transport. Several advanced experimental design strategies can be employed:

  • Design of Experiments (DoE) Methodology: Rather than the inefficient one-factor-at-a-time approach, DoE allows researchers to systematically explore multiple factors affecting RnfG function simultaneously, taking into account their interactions . This approach is particularly valuable for optimizing expression, purification, and functional assay conditions for RnfG.

  • Mixed Methods Research: Combining qualitative and quantitative approaches provides a more comprehensive understanding of complex systems like the Rnf complex . For RnfG, this might involve integrating structural studies with functional assays.

  • Research Question Development:

    Question TypeExample for RnfG Research
    DescriptiveWhat is the redox potential of RnfG's FMN cofactor?
    InferentialHow does mutation of specific residues affect RnfG's redox properties?
    ProcessHow does electron transfer through RnfG couple to Na+ transport?

    Following established principles for writing research questions can help guide experimental design .

  • Systematic Mutation Analysis: Creating a series of RnfG variants with specific mutations can help identify residues critical for FMN binding, electron transfer, and interaction with other Rnf complex subunits. This approach was illustrated by the Thr166Gly mutation in M. acetivorans RnfG .

  • Control Variables: When studying RnfG function, controlling for variables such as pH, temperature, salt concentration, and the presence of specific ions (particularly Na+) is crucial for obtaining reliable results .

By adopting these experimental design approaches, researchers can systematically investigate the function of RnfG within the Rnf complex, its role in electron transfer and ion transport, and the structural features critical for these functions.

How do mutations in the FMN-binding site affect RnfG's redox properties?

While comprehensive data on multiple mutations is limited, several potential effects can be predicted based on the known properties of FMN binding sites and flavoproteins:

  • Effects on FMN Binding Affinity: Mutations of residues directly involved in FMN binding can reduce the binding affinity, potentially leading to substoichiometric FMN incorporation or complete loss of the cofactor, as seen with the Thr166Gly mutation .

  • Alteration of Redox Potential: The redox potential of bound FMN (-129 mV in wild-type M. acetivorans RnfG ) can be shifted by mutations that alter the electrostatic environment around the cofactor:

    • Introduction of positively charged residues → More positive potential (facilitates reduction)

    • Introduction of negatively charged residues → More negative potential (facilitates oxidation)

  • Changes in Electron Transfer Kinetics: Mutations that affect the positioning of FMN within RnfG can alter its distance from electron donors or acceptors, impacting the rate of electron transfer according to Marcus theory.

  • Effects on Proton Coupling: Flavin redox reactions often involve proton transfer. Mutations that disrupt proton transfer pathways can affect the coupling of electron and proton movements, potentially altering the pH dependence of the redox reaction.

To systematically study these effects, researchers could employ site-directed mutagenesis to create a panel of RnfG variants with mutations in the FMN binding site, followed by redox titrations, spectroscopic analysis, and functional assays to characterize their properties.

How does RnfG interact with other subunits of the Rnf complex to facilitate ion transport?

The interaction of RnfG with other subunits of the Rnf complex to facilitate ion transport is a complex process that involves both direct protein-protein interactions and the coordinated transfer of electrons. While detailed structural information about these interactions is limited, several key aspects can be inferred:

  • Structural Organization: The Rnf complex consists of six subunits (RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG), with two (likely RnfD and RnfE) being membrane integral and the other four being cytosolic or membrane-associated . RnfG contains a transmembrane helix and is associated with the membrane, with its FMN-containing C-terminal domain located on the outer aspect of the cytoplasmic membrane .

  • Electron Transfer Pathway:

    ProteinFunction in Electron Transport
    RnfBAccepts electrons from reduced ferredoxin
    RnfATransfers electrons to RnfG
    RnfGFMN-containing intermediate carrier
    RnfCContains NAD+ binding site
    RnfD/EMediate Na+ transport

    This pathway suggests that RnfG forms direct electron transfer interfaces with RnfA (receiving electrons) and potentially with components that subsequently transfer electrons to RnfC .

  • Coupling to Ion Transport: While RnfG itself may not directly transport ions, its electron transfer activity contributes to the energetics of the process, potentially inducing conformational changes in RnfD and RnfE that facilitate Na+ movement .

  • Conformational Dynamics: The transfer of electrons through RnfG, particularly the reduction and oxidation of its FMN cofactor, likely induces conformational changes in the protein. These changes could be transmitted to interacting subunits, particularly the ion-transporting RnfD and RnfE, altering their conformation in a way that facilitates Na+ transport.

A comprehensive understanding of these interactions would benefit from structural studies of the intact complex, functional studies with reconstituted systems, and mutagenesis studies targeting potential interaction interfaces.

What experimental approaches can resolve contradictory data about RnfG function?

When faced with contradictory data about RnfG function, researchers can employ several advanced experimental approaches to resolve these discrepancies:

  • Multi-Method Validation: Employing multiple, complementary experimental techniques to study the same aspect of RnfG function can help confirm findings and identify artifacts or limitations of individual methods. This approach is similar to the concept of triangulation in mixed methods research , where data from different sources are used to verify findings.

  • Systematic Variation of Experimental Conditions: Contradictory results might arise from differences in experimental conditions. Using Design of Experiments (DoE) methodology , researchers can systematically vary conditions (pH, temperature, salt concentration, detergent type, etc.) to identify factors that influence RnfG function and potentially explain contradictory data.

  • Genetic and Biochemical Complementation: If contradictory results emerge from studies using different organisms or expression systems, complementation experiments can be valuable. For instance, expressing E. tasmaniensis RnfG in an rnfG knockout strain of another organism and testing for functional complementation can help determine whether functional differences are intrinsic to the protein or due to the experimental system.

  • Structure-Function Analysis Matrix:

    Mutation TypeExperimental ApproachExpected Outcome
    FMN binding siteRedox titration, fluorescenceChanged/lost FMN binding
    Transmembrane domainMembrane localization assayAltered membrane association
    Protein-protein interaction sitesCo-immunoprecipitation, crosslinkingChanged interaction with other Rnf subunits
    Conserved residues across speciesFunctional complementationIdentification of universally important residues

    Creating a panel of RnfG variants with specific mutations and testing their function can help resolve contradictions about which residues or domains are critical for particular aspects of RnfG function .

  • Reconstitution Experiments: Reconstituting purified RnfG (either alone or as part of the entire Rnf complex) into defined liposome systems allows precise control over the experimental environment. This approach can help determine whether contradictory results arise from differences in the native membrane environment or other cellular factors.

By employing these approaches, researchers can work toward resolving contradictions in the data about RnfG function, ultimately developing a more comprehensive and accurate understanding of its role in the Rnf complex and bacterial energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.