Recombinant Erwinia tasmaniensis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Overview of Erwinia tasmaniensis

Erwinia tasmaniensis is a Gram-negative bacterium found on apple and pear trees in Australia . It's closely related to pathogenic Erwinia species but is non-phytopathogenic . E. tasmaniensis Et1/99 is an obligate aerobe and mesophilic bacterium .

Large-conductance Mechanosensitive Channel (MscL)

MscL is a mechanosensitive channel that responds to mechanical stimuli in the cell membrane . MscL channels are found in various organisms and act as emergency release valves, opening pores in response to membrane stretching . This mechanism helps the cell maintain osmotic balance and prevent lysis by releasing solutes .

Recombinant MscL from Erwinia tasmaniensis

Recombinant MscL refers to the MscL protein produced through recombinant DNA technology . The gene encoding MscL from Erwinia tasmaniensis is expressed in a host organism to produce large quantities of the protein . This allows for detailed studies of its structure, function, and regulation.

ELISA for Recombinant Erwinia tasmaniensis MscL

An ELISA (Enzyme-Linked Immunosorbent Assay) kit is available for detecting recombinant Erwinia tasmaniensis Large-conductance mechanosensitive channel (MscL) . This ELISA can be used in research to quantify the expression levels of MscL in different experimental conditions .

Research Findings and Applications

Although limited information is available, research on MscL channels, in general, suggests several potential applications:

  • Drug Discovery: MscL channels are potential targets for developing new antimicrobial drugs .

  • Biotechnology: MscL can be used in biotechnological applications that require controlled release of molecules from cells .

  • Basic Research: Studying MscL provides insights into mechanosensation and membrane biophysics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; ETA_31320; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
mscL
Target Protein Sequence
MSMFKEFRDFAMRGNVVDLAVGVIIGAAFGKIVSSLVANIIMPPLGLLIGGVDFKQFSWI LKPADGAAPAVVMEYGVFLQTVFDFVIVAFAIFMAIKLMNRLYTKKEVEKPVAKPSAEET LLSEIRDLLKEQNGKAQ
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia tasmaniensis and how is it characterized in laboratory settings?

Erwinia tasmaniensis is a non-phytopathogenic bacterial species first isolated from flowers and bark of apple and pear trees in Australia (Victoria, Tasmania, and Queensland) . Laboratory characterization involves several distinct approaches:

The bacteria form white colonies with dome-shaped morphology when grown on nutrient agar supplemented with sucrose . Identification and classification require a polyphasic approach including:

  • Microbiological and API assays for biochemical profiling

  • Fatty acid methyl ester analysis for chemotaxonomic characterization

  • DNA-DNA hybridization to determine genomic similarities with related species

  • Molecular classification through 16S rRNA, gpd, and recA gene sequencing

The type strain is designated as Et1/99(T) (=DSM 17950(T)=NCPPB 4357(T)) and serves as the reference for species identification . While phylogenetically related to pathogenic Erwinia species, E. tasmaniensis is non-pathogenic on apples and pears, making it valuable for research applications where pathogenicity could be problematic .

What are mechanosensitive channels and why is MscL significant in research?

Mechanosensitive channels function as molecular transducers that respond to mechanical forces exerted on cell membranes by opening in response to membrane bilayer deformations . The mechanosensitive channel of large conductance (MscL) is particularly significant because:

  • It serves as a safety valve in bacteria, protecting cells from hypoosmotic shock by opening under membrane tension to relieve excessive turgor pressure

  • It responds to specific membrane tension thresholds (approximately 10-12 mN/m)

  • It has exceptionally high nonselective conductance (~3 nS), making it ideal for studying channel gating mechanisms

  • It is one of the best characterized membrane channels in both structural and functional terms, providing a valuable model system for understanding mechanosensation mechanisms

The channel's structure-function relationship has been extensively characterized using multiple complementary techniques, making it an excellent model for studying membrane protein dynamics and conformational changes .

How do you confirm the identity of Erwinia tasmaniensis isolates in laboratory settings?

Proper identification of E. tasmaniensis requires multiple confirmatory approaches to avoid misidentification with closely related species:

  • Morphological examination: Look for white colonies with characteristic dome-shaped morphology on sucrose-containing agar

  • Biochemical differentiation: E. tasmaniensis can be distinguished from close relatives like E. billingiae through specific biochemical tests:

    • Utilizes rhamnose but not citrate

    • Reduces nitrates to nitrites (unlike some related species)

  • Molecular confirmation: 16S rRNA gene sequencing is essential, with:

    • E. tasmaniensis typically showing 98.9% 16S rRNA sequence similarity to the type strain Et1/99

    • Comparison with other Erwinia species like E. toletana (98.8% similarity) and E. billingiae (98.1% similarity)

  • Phylogenetic analysis: Construction of phylogenetic trees based on 16S rRNA sequences to confirm clustering with E. tasmaniensis reference strains

According to Stackbrandt and Ebers, strains with less than 99% 16S rRNA gene sequence similarity to known species should be subjected to further testing as potential novel species .

How can patch clamp and FRET techniques be combined to study MscL conformational changes?

A sophisticated dual-measurement approach combines patch clamp electrophysiology with fluorescence resonance energy transfer (FRET) spectroscopy to simultaneously monitor MscL function and structural changes:

Methodology Integration:

  • Experimental setup: Establish a system where patch clamp recordings can be performed while simultaneously monitoring FRET signals from labeled MscL channels

  • Membrane preparation: Express recombinant MscL proteins with strategic fluorophore labeling at key residues to monitor conformational changes during channel opening

  • Control of channel state: Modify lateral pressure distribution in the lipid bilayer to control channel opening while maintaining the protein in its natural membrane environment

  • Data correlation: Record channel conductance via patch clamp while simultaneously measuring changes in FRET efficiency as an indicator of conformational change

This combined approach provides several advantages:

  • Allows direct correlation between structural rearrangements and channel function

  • Maintains physiological conditions similar to those used in standard electrophysiological recordings

  • Enables monitoring of protein conformation in a native lipid environment

The method has revealed that transitioning to the open state involves more subtle conformational changes than previously proposed, with the N-terminus remaining anchored at the membrane surface where it can translate membrane tension to conformational changes in the pore-lining helix .

What are the key considerations when designing experiments to detect recombination in bacterial gene sequences?

Detecting recombination events in bacterial genomes requires careful experimental design and analytical approaches:

Methodological Framework:

  • Sampling Strategy:

    • Include sufficient strain diversity to capture potential recombination events

    • Sequence multiple genes to identify incongruent phylogenetic signals

  • Detection Methods: Employ multiple complementary approaches for robust detection:

    • RDP (Recombination Detection Program): Uses sliding window to calculate pairwise distances between taxon triplets

    • GENECONV: Identifies unusually similar segments between sequences that may indicate gene conversion

    • MaxChi and Chimaera: Detect breakpoints by comparing variable sites on either side of each position

    • 3Seq: Tests for recombination using three-sequence comparisons

  • Validation Criteria:

    • Consider recombination events valid only when detected by at least three different analytical methods

    • Focus on events identified across all five methods for highest confidence

Data Interpretation:

  • Visualize recombination breakpoints in the context of gene boundaries

  • Consider the distribution of conflicting phylogenetic signals across the genome

  • Distinguish between recombination and other evolutionary processes that may produce similar signals

In the case study of Pantoea (related to Erwinia), researchers identified 110 likely recombination events across 54 genomic regions, with 57 events supported by all five analytical methods .

How do genetic variations in MscL affect channel conductance and gating properties?

The relationship between MscL genetic variations and functional properties can be systematically investigated through site-directed mutagenesis and functional characterization:

Structure-Function Analysis Approach:

  • Target residue identification:

    • Focus on transmembrane domains and pore-lining residues

    • Investigate N-terminal residues that anchor to the membrane surface

    • Examine residues involved in helix-helix interactions

  • Mutational strategy:

    • Create conservative and non-conservative substitutions

    • Generate chimeric channels between E. tasmaniensis MscL and other bacterial MscLs

    • Develop deletion constructs to assess domain contributions

  • Functional assessment:

    • Measure conductance using patch clamp (typical wild-type conductance: ~3 nS)

    • Determine tension threshold for activation (wild-type: 10-12 mN/m)

    • Assess ion selectivity changes through reversal potential measurements

Relationship Between Structure and Function:

DomainMutation TypeEffect on ConductanceEffect on Tension ThresholdStructural Impact
TM1 (pore-lining)Hydrophobic→HydrophilicIncreasedDecreasedDestabilized closed state
TM2 (outer helix)Hydrophilic→HydrophobicMinor changeIncreasedEnhanced membrane coupling
N-terminusDeletionReducedIncreasedDisrupted force transmission
C-terminusCharge alterationMinimal effectMinimal effectLimited role in gating

This systematic approach reveals how specific residues contribute to channel function and can identify key differences between E. tasmaniensis MscL and channels from other bacterial species .

How can molecular dynamics simulations be integrated with experimental data to understand MscL gating mechanisms?

Integrating molecular dynamics (MD) simulations with experimental data provides powerful insights into MscL structure and function:

Integrated Methodology:

  • Initial structure preparation:

    • Develop homology models based on crystal structures and sequence alignments

    • Incorporate distance constraints from FRET and EPR measurements

    • Embed models in appropriate lipid bilayers mimicking experimental conditions

  • Simulation protocols:

    • Equilibrate the closed-state system

    • Apply membrane tension gradually to capture the gating transition

    • Perform multiple independent simulations to ensure reproducibility

    • Calculate free energy profiles along the transition pathway

  • Validation with experimental data:

    • Compare simulated conductance with patch clamp measurements

    • Verify conformational changes against FRET distance measurements

    • Validate ion and water permeation pathways

  • Iterative refinement:

    • Use simulation predictions to design new experimental tests

    • Revise models based on experimental feedback

    • Develop testable hypotheses about channel gating mechanisms

This approach has revealed that the N-terminus plays a crucial role in MscL function, remaining anchored at the membrane surface where it can either guide the tilt of or directly translate membrane tension to conformational changes in the pore-lining helix .

How should researchers design and analyze experimental controls when studying recombinant MscL function?

Rigorous experimental controls are essential for reliable characterization of recombinant MscL function:

Control Framework for Functional Studies:

  • Negative controls:

    • Empty vector-transformed cells to assess background mechanosensitivity

    • Heat-inactivated protein preparations to confirm specific activity

    • Non-mechanosensitive membrane proteins to validate tension specificity

  • Positive controls:

    • Well-characterized MscL variants (e.g., E. coli MscL)

    • Gain-of-function mutants with known altered gating properties

    • Wild-type channels in native membrane environment

  • Technical controls:

    • Multiple membrane patch preparations to account for variability

    • Repeated measurements under identical conditions

    • Calibration of membrane tension using established methods

Data Analysis Considerations:

ParameterAnalysis MethodControl ComparisonStatistical Approach
Activation thresholdBoltzmann distribution fittingCompare with wild-typeTwo-tailed t-test
Channel conductanceSingle-channel analysisCompare across expression systemsANOVA with post-hoc tests
Inactivation kineticsExponential decay fittingCompare before/after treatmentsPaired statistical tests
Ion selectivityReversal potential measurementCompare with theoretical valuesChi-square goodness of fit

For Latin square experimental designs, analysis should employ ANOVA with appropriate partitioning of variance to remove row and column effects . This approach ensures that observed differences in channel function can be reliably attributed to the experimental variables rather than technical artifacts or inherent variability in the system.

What are common challenges in recombinant MscL expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant MscL proteins:

Problem 1: Low expression levels

  • Possible causes:

    • Codon bias incompatibility with host organism

    • Toxicity of expressed channel to host cells

    • Inefficient transcription or translation

  • Solutions:

    • Optimize codon usage for E. coli or use Rosetta strains with rare tRNAs

    • Use tightly controlled expression systems (e.g., pBAD) with inducible promoters

    • Lower induction temperature to 18-20°C and extend expression time

    • Screen multiple E. coli strains (BL21, C41, C43) optimized for membrane proteins

Problem 2: Inclusion body formation

  • Possible causes:

    • Overexpression exceeding membrane capacity

    • Improper folding in the host system

    • Suboptimal detergent solubilization

  • Solutions:

    • Reduce expression level by lowering inducer concentration

    • Co-express with molecular chaperones (GroEL/GroES)

    • Try fusion partners that enhance solubility (MBP, SUMO)

    • Optimize membrane extraction conditions with different detergents

Problem 3: Non-functional protein

  • Possible causes:

    • Improper folding or pentamer assembly

    • Detergent effects on protein conformation

    • Interference from affinity tags

  • Solutions:

    • Verify oligomeric state by size exclusion chromatography

    • Test different detergents or lipid reconstitution methods

    • Place affinity tags at alternative termini or include longer linkers

    • Perform functional assays in native-like membrane environments

Each optimization step should be systematically tested and documented to develop a reliable protocol for the specific recombinant MscL variant being studied .

How can researchers address conflicting phylogenetic signals when analyzing Erwinia species relationships?

Conflicting phylogenetic signals in Erwinia species analysis present significant challenges that can be addressed through systematic approaches:

Problem Assessment:

  • Quantification of conflict:

    • Calculate quartet scores for alternative topologies at each node

    • Identify specific nucleotide sites supporting conflicting relationships

    • Map these sites across the genome to determine distribution patterns

  • Source identification:

    • Distinguish between stochastic errors, analytical artifacts, and biological processes

    • Test for recombination using multiple detection methods

    • Evaluate potential incomplete lineage sorting through coalescent modeling

Resolution Strategies:

  • Methodological approaches:

    • Apply both concatenation-based (AML) and coalescent-based (MSC) methods

    • Compare results from multiple tree-building algorithms

    • Use network-based visualization (e.g., Neighbor-Net) to represent conflicting signals

  • Data filtering:

    • Remove genes with strongest recombination signals

    • Exclude third codon positions or fast-evolving sites

    • Create subsets of genes with congruent phylogenetic signals

  • Comparative analysis:

    • Examine different lineages separately (e.g., P. ananatis vs. P. dispersa lineages)

    • Compare patterns of conflict across different species groups

    • Focus on genomic regions with minimal recombination

In a similar study with Pantoea, researchers found that nucleotide sites supporting conflicting topologies were distributed across the genome rather than concentrated in specific regions (3,856 nucleotide positions in the P. dispersa lineage and 1,764 in the P. ananatis lineage) . This pattern suggests that recombination is widespread but involves small genomic segments, requiring careful analytical approaches to reconstruct accurate phylogenetic relationships.

What strategies can minimize experimental artifacts when studying MscL channel gating using electrophysiological techniques?

Accurate electrophysiological characterization of MscL gating requires careful attention to potential artifacts:

Common Artifacts and Mitigation Strategies:

  • Membrane instability artifacts:

    • Problem: Spontaneous membrane breakdown under tension can be mistaken for channel opening

    • Solution: Establish clear membrane stability criteria; compare with negative controls; verify reproducible channel conductance levels

  • Pressure application artifacts:

    • Problem: Uneven or inconsistent pressure application leads to variable channel activation

    • Solution: Use automated pressure control systems; calibrate pressure transducers; employ standardized protocols for pressure/tension conversion

  • Lipid environment effects:

    • Problem: Different lipid compositions alter channel gating characteristics

    • Solution: Systematically test defined lipid mixtures; document lipid dependencies; use consistent membrane compositions for comparative studies

Validation Framework:

Artifact TypeDetection MethodMitigation ApproachValidation Criterion
Spontaneous openingsControl recordingsReduce holding potentialTension-dependent activation
Electrode driftBaseline monitoringRegular recalibrationStable baseline over time
Mechanosensitive contaminantsSingle-channel analysisRigorous purificationConsistent conductance levels
Non-specific membrane effectsTension threshold analysisMembrane capacitance monitoringReproducible activation curve

For combined patch clamp and FRET studies, additional controls are needed to ensure that fluorophore labeling doesn't alter channel function and that FRET measurements accurately reflect conformational changes rather than environmental effects .

By implementing these strategies, researchers can obtain reliable electrophysiological data on MscL gating properties while minimizing potential experimental artifacts that could lead to misinterpretation of channel behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.