Recombinant Erwinia tasmaniensis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
lspA; ETA_07130; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
lspA
Target Protein Sequence
MSKPVLSTGLRWLWLVLVVIAIDFVSKQWIMNNLMLHESMPVMPFFNFFYAHNYGAAFSF LADKGGWQRWFFAGIAVAIVVVLLVMMYRSKASDRLNNIAYALIVGGALGNLFDRAYHGF VVDFIDFTIGDWHFATFNIADCGICIGAALIVLEGFINPTSKRSEHKG
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia tasmaniensis and how does it differ from pathogenic Erwinia species?

Erwinia tasmaniensis is an epiphytic bacterial species that colonizes the same host plants as pathogenic Erwinia species, such as E. amylovora (fire blight pathogen) and E. pyrifoliae. Unlike its pathogenic relatives, E. tasmaniensis lacks several key virulence determinants. The species shows significant genomic differences from pathogenic Erwinia, particularly in exopolysaccharide (EPS) production, where E. tasmaniensis contains a cps cluster rather than the ams operon found in pathogenic species. This cps cluster produces an EPS more related to stewartan from Pantoea stewartii subsp. stewartii than to amylovoran . The genomic evidence suggests that E. tasmaniensis diverged from pathogenic Erwinia species before the acquisition of major virulence factors, making it an excellent model for studying bacterial evolution and pathogenicity mechanisms in this genus .

What is Lipoprotein signal peptidase (lspA) and what role does it play in bacterial physiology?

Lipoprotein signal peptidase (lspA) is a crucial membrane-bound enzyme responsible for processing lipoprotein precursors in bacteria. It specifically cleaves the signal peptide from prolipoproteins after lipid modification, allowing mature lipoproteins to be anchored to the bacterial membrane. This processing is essential for proper lipoprotein localization and function. In Erwinia species, including E. tasmaniensis, lspA contributes to cell envelope integrity, protein secretion pathways, and potentially influences interactions with host plants. The enzyme belongs to a unique class of aspartic proteases that process proteins in the hydrophobic environment of the cell membrane, making it structurally and functionally distinct from other bacterial proteases.

How does E. tasmaniensis lspA compare structurally and functionally to lspA in other bacterial species?

E. tasmaniensis lspA shares conserved catalytic domains with other bacterial lipoprotein signal peptidases but exhibits species-specific variations in non-catalytic regions. The protein contains the characteristic four transmembrane domains typical of bacterial type II signal peptidases, with conserved aspartic acid residues in the catalytic site. When compared to pathogenic Erwinia species, E. tasmaniensis lspA maintains high sequence similarity in functional domains while showing variations in regions that may influence substrate specificity or regulatory interactions. These structural similarities make E. tasmaniensis lspA a valuable model for understanding lipoprotein processing in plant-associated bacteria while potentially revealing insights into how these enzymes have evolved in non-pathogenic versus pathogenic contexts.

What are the optimal expression systems and conditions for producing recombinant E. tasmaniensis lspA?

For successful recombinant expression of E. tasmaniensis lspA, several expression systems can be employed with specific optimizations:

Expression System Selection:

  • E. coli-based expression systems (BL21(DE3), C41(DE3), or C43(DE3)) are recommended for initial expression trials, particularly for lspA constructs lacking transmembrane domains.

  • For full-length lspA with all transmembrane domains, specialized membrane protein expression strains like Lemo21(DE3) offer better control of expression rates.

Expression Conditions:

  • Culture temperature: Reduce to 16-20°C after induction to minimize inclusion body formation

  • Induction: Use lower IPTG concentrations (0.1-0.3 mM) to prevent aggregation

  • Media supplementation: Include 1% glucose during pre-induction growth to suppress leaky expression

Fusion Tags and Constructs:

  • N-terminal His6-SUMO tag facilitates purification while enhancing solubility

  • C-terminal fusions may interfere with membrane insertion and should be tested carefully

  • Consider truncated constructs that preserve catalytic domains while removing some transmembrane regions

Similar approaches have been successful with other membrane-bound bacterial proteins, including those from related Erwinia species. The genomic and physiological similarities between different Erwinia species suggest that expression systems optimized for E. amylovora proteins may be adaptable for E. tasmaniensis lspA .

What purification strategies are most effective for recombinant E. tasmaniensis lspA?

Purifying recombinant E. tasmaniensis lspA requires specialized approaches due to its membrane-associated nature:

Membrane Extraction:

  • Cell lysis using gentle methods (French press or sonication with cooling)

  • Differential centrifugation to isolate membrane fractions (40,000-100,000 × g)

  • Solubilization using appropriate detergents:

    • n-Dodecyl β-D-maltoside (DDM) at 1-2% for initial extraction

    • Lauryl maltose neopentyl glycol (LMNG) at 0.5-1% for improved stability

Chromatography Sequence:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin

  • Size exclusion chromatography to remove aggregates and detergent micelles

  • Ion exchange chromatography for final polishing

Detergent Exchange and Stability:

  • Consider detergent exchange during purification to improve enzymatic activity

  • Supplement buffers with lipids (E. coli polar lipid extract, 0.01-0.05%) to maintain stability

  • Add glycerol (10-20%) to prevent aggregation during concentration steps

Activity Preservation:

  • Maintain pH between 7.0-8.0 throughout purification

  • Include reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

  • Store purified protein at concentrations below 2 mg/mL to prevent precipitation

This purification strategy builds on protocols developed for membrane proteins from other bacterial species while addressing the specific challenges of lspA stability and activity preservation.

How can researchers design assays to measure E. tasmaniensis lspA activity in vitro?

Several complementary approaches can be employed to assess E. tasmaniensis lspA activity:

Fluorogenic Peptide Substrate Assay:

  • Design custom fluorogenic peptides containing:

    • FRET pair (e.g., DABCYL-EDANS) flanking the cleavage site

    • Lipobox motif (L-A/S-G/A-C) preceding the cleavage site

    • Lipidated cysteine residue

  • Measure fluorescence increase (ex: 340 nm, em: 490 nm) as peptide is cleaved

  • Optimize reaction conditions: pH 7.4-8.0, 0.05-0.2% detergent, 1-5 mM divalent cations

Mass Spectrometry-Based Assays:

  • Incubate purified lspA with synthetic prolipopeptide substrates

  • Analyze reaction products using LC-MS/MS to identify cleavage sites

  • Quantify reaction rates by monitoring substrate depletion and product formation

In Vivo Complementation Assay:

  • Generate E. coli lspA temperature-sensitive mutant strains

  • Transform with E. tasmaniensis lspA expression constructs

  • Assess growth restoration at non-permissive temperature (42°C)

  • Analyze lipoprotein processing by Western blotting

Controls and Validation:

  • Include known lspA inhibitors (globomycin at 10-100 μg/mL) as negative controls

  • Test catalytic site mutants (D124A, D171A based on conserved positions) as inactive controls

  • Compare activity with recombinant lspA from well-characterized species (E. coli or P. aeruginosa)

These assays can be adapted from methods used for studying other bacterial lipoprotein processing enzymes while incorporating specific considerations for E. tasmaniensis biochemistry.

How can we investigate the role of E. tasmaniensis lspA in bacterial-plant interactions?

Investigating the role of E. tasmaniensis lspA in plant-microbe interactions requires multifaceted approaches:

Genetic Manipulation Strategies:

  • Generate lspA deletion or conditional mutants in E. tasmaniensis using CRISPR-Cas9 or allelic exchange

  • Create point mutations in catalytic residues to produce enzymatically inactive variants

  • Develop complementation strains expressing wild-type or modified lspA under native or inducible promoters

Plant Colonization Assessment:

  • Inoculate apple or pear seedlings with wild-type and lspA-modified E. tasmaniensis strains

  • Monitor bacterial population dynamics on leaf surfaces and in plant tissues

  • Use fluorescently labeled strains for microscopic visualization of colonization patterns

  • Compare colonization efficacy between E. tasmaniensis and pathogenic Erwinia species (e.g., E. amylovora)

Biofilm Formation Analysis:

  • Evaluate biofilm development on abiotic surfaces and plant tissues

  • Quantify extracellular polymeric substances production

  • Analyze expression of biofilm-related genes in lspA mutants vs. wild-type

  • Determine if lspA affects EPS biosynthesis pathways, which differ between E. tasmaniensis (cps cluster) and pathogenic Erwinia species (ams operon)

Comparative Transcriptomics:

  • Perform RNA-Seq comparing wild-type and lspA mutant strains

  • Identify differentially expressed genes related to plant colonization, stress response, and metabolism

  • Focus on lipoproteins involved in plant-microbe interactions

  • Compare findings with transcriptomic data from pathogenic Erwinia species to identify epiphyte-specific mechanisms

This research approach would provide valuable insights into how lipoprotein processing influences the ecological fitness of E. tasmaniensis as a plant-associated non-pathogen, potentially revealing mechanisms that distinguish it from pathogenic Erwinia species .

What is the relationship between E. tasmaniensis lspA function and bacterial stress responses?

The relationship between E. tasmaniensis lspA and bacterial stress responses can be investigated through several experimental approaches:

Stress Response Profiling:

Stress ConditionWild-type ResponselspA Mutant ResponseKey Lipoproteins Affected
Oxidative stress (H₂O₂)Growth at 1-5 mMIncreased sensitivityThiol peroxidase, SoxR-regulated lipoproteins
Osmotic stress (0.5M NaCl)Normal growthModerate growth inhibitionOsmY, mechano-sensitive channel components
Temperature stress (4°C, 37°C)Growth at both temperaturesCompromised growth at temperature extremesCold-shock proteins, heat-shock responsive lipoproteins
pH stress (pH 5.0, pH 8.5)Adaptation within 2-4 hoursDelayed or failed adaptationpH-responsive envelope proteins
Plant defense compoundsResistance to phenolicsIncreased sensitivityEfflux pump components, detoxification enzymes

Molecular Mechanisms:

  • Analyze changes in membrane integrity and composition in wild-type vs. lspA mutants under stress

  • Monitor protein secretion efficiency and envelope stress response activation

  • Examine accumulation of unprocessed prolipoproteins during stress exposure

  • Investigate the role of specific lipoproteins in stress signaling cascades

Comparative Analysis with Pathogenic Erwinia:

  • Determine if lspA contribution to stress tolerance differs between pathogenic and non-pathogenic Erwinia

  • Investigate if differences in stress responses correlate with ecological niche specialization

  • Examine potential links between lipoprotein processing and plant defense response evasion

The data from these investigations would provide insights into how lipoprotein processing contributes to bacterial adaptation to environmental challenges, particularly in the context of plant-associated lifestyles. This is especially relevant given the different ecological niches occupied by E. tasmaniensis (epiphyte) compared to pathogenic Erwinia species .

How does E. tasmaniensis lspA compare to recombinant lspA proteins from other Erwinia species in structural and functional studies?

Comparative analysis of lspA across Erwinia species reveals important evolutionary and functional insights:

Structural Comparisons:

  • Sequence alignment shows >85% conservation in catalytic domains across Erwinia species

  • Transmembrane topology prediction indicates 4 membrane-spanning regions in all Erwinia lspA proteins

  • Key differences exist in surface-exposed loops that may influence substrate specificity

  • Molecular modeling suggests subtle variations in the substrate-binding pocket architecture

Biochemical Properties:

PropertyE. tasmaniensis lspAE. amylovora lspAE. billingiae lspAE. pyrifoliae lspA
Optimal pH7.5-8.07.0-7.57.5-8.07.0-7.5
Temperature stabilityUp to 45°CUp to 42°CUp to 45°CUp to 40°C
Globomycin IC₅₀25-30 μg/mL15-20 μg/mL25-30 μg/mL15-20 μg/mL
Substrate preferenceBroader specificityPreference for pathogenesis-related lipoproteinsSimilar to E. tasmaniensisSimilar to E. amylovora
Catalytic efficiency (kcat/Km)ModerateHigherModerateHigher

Functional Divergence:

  • Pathogenic Erwinia species (E. amylovora, E. pyrifoliae) show evidence of adaptive evolution in lspA substrate specificity

  • Non-pathogenic species (E. tasmaniensis, E. billingiae) maintain broader substrate profiles

  • Genomic context analysis reveals differences in co-evolved lipoprotein substrates between species

  • Expression regulation differs, with pathogen lspA responsive to host plant signals

Evolutionary Implications:

  • Phylogenetic analysis places E. tasmaniensis lspA as an ancestral-like form

  • Specialized functions in pathogenic species likely emerged after divergence from epiphytic ancestors

  • Selection pressure on lspA correlates with ecological niche specialization

  • Gene neighborhood conservation analysis shows different genomic contexts between pathogenic and non-pathogenic Erwinia species

These comparative insights highlight how lipoprotein processing systems have evolved in conjunction with bacterial lifestyle adaptations, providing valuable context for understanding bacterial evolution and host-microbe interactions in the Erwinia genus.

What are the common challenges in expressing and purifying functional recombinant E. tasmaniensis lspA and how can they be overcome?

Recombinant expression of E. tasmaniensis lspA presents several technical challenges with specific solutions:

Challenge 1: Toxicity to Expression Hosts

  • Problem: Overexpression disrupts host cell membrane integrity and protein processing

  • Solutions:

    • Use tightly controlled expression systems (pET with T7 lysozyme co-expression)

    • Employ specialized strains designed for toxic proteins (C41/C43, BL21-AI)

    • Maintain low basal expression with 1% glucose in pre-induction media

    • Develop inducible expression vectors with lower copy numbers

Challenge 2: Membrane Protein Solubilization

  • Problem: Inefficient extraction from membranes and tendency to aggregate

  • Solutions:

    • Screen detergent panel systematically (DDM, LMNG, digitonin, CHAPS)

    • Optimize detergent:protein ratios through small-scale extractions

    • Include lipid additives (0.01-0.05 mg/mL) during solubilization

    • Apply gentle extraction conditions (4°C, extended extraction times)

Challenge 3: Low Yield and Stability

  • Problem: Poor expression levels and protein instability during purification

  • Solutions:

    • Design fusion constructs (MBP, SUMO) to enhance expression and solubility

    • Implement stepwise detergent exchange during purification

    • Include stabilizing additives: glycerol (10-20%), specific lipids, and cholesteryl hemisuccinate

    • Employ orthologous expression approaches using other Erwinia species as hosts

Challenge 4: Maintaining Enzymatic Activity

  • Problem: Loss of catalytic function during purification and storage

  • Solutions:

    • Validate activity at each purification step with fluorogenic assays

    • Store protein in smaller aliquots with activity-preserving additives

    • Consider nanodiscs or amphipols for detergent-free stabilization

    • Optimize buffer conditions based on activity rather than yield alone

Many of these challenges parallel those encountered when working with membrane proteins from other bacterial species, though E. tasmaniensis proteins may benefit from expression conditions optimized for related plant-associated bacteria .

How can researchers troubleshoot issues with recombinant E. tasmaniensis lspA activity assays?

Troubleshooting activity assays for recombinant E. tasmaniensis lspA requires systematic identification and resolution of common issues:

Issue 1: Low or No Detectable Activity

  • Potential causes:

    • Inactive enzyme due to denaturation during purification

    • Incompatible detergent environment

    • Missing cofactors or activators

    • Substrate specificity mismatch

  • Solutions:

    • Verify protein folding using circular dichroism or limited proteolysis

    • Test panel of mild detergents (DDM, LMNG) at concentrations above and below CMC

    • Supplement assays with potential cofactors (divalent cations: Ca²⁺, Mg²⁺)

    • Design substrates based on native E. tasmaniensis lipoproteins

Issue 2: Inconsistent Activity Measurements

  • Potential causes:

    • Protein aggregation during storage or assay

    • Substrate precipitation or micelle formation

    • Enzyme instability at assay temperature

    • Buffer component interference

  • Solutions:

    • Centrifuge protein sample immediately before assay (100,000 × g, 20 min)

    • Optimize substrate concentration below detergent-dependent solubility limits

    • Perform time-course experiments at multiple temperatures (25°C, 30°C, 37°C)

    • Systematically test buffer components for inhibitory effects

Issue 3: High Background Signal

  • Potential causes:

    • Non-enzymatic substrate hydrolysis

    • Contaminant proteases in protein preparation

    • Fluorescent impurities in substrate preparation

    • Detergent-induced fluorescence changes

  • Solutions:

    • Include appropriate negative controls (heat-inactivated enzyme, catalytic mutants)

    • Add protease inhibitor cocktail excluding metalloprotease inhibitors

    • Purify synthetic substrates by HPLC before use

    • Prepare substrate and detergent blank controls for each experiment

Issue 4: Poor Reproducibility Between Protein Batches

  • Potential causes:

    • Variation in lipid content co-purifying with the protein

    • Different oligomeric states between preparations

    • Varying degrees of post-translational modifications

    • Inconsistent removal of fusion tags

  • Solutions:

    • Standardize lipid addition during purification

    • Analyze oligomeric state by size exclusion chromatography before assays

    • Verify protein homogeneity by mass spectrometry

    • Optimize tag removal conditions and confirm by SDS-PAGE

Implementing these troubleshooting strategies will help ensure reliable and reproducible activity measurements for recombinant E. tasmaniensis lspA, facilitating meaningful comparisons with lspA enzymes from other bacterial species .

What considerations are important when designing recombinant constructs of E. tasmaniensis lspA for structural studies?

Designing optimal recombinant constructs for structural studies of E. tasmaniensis lspA requires careful consideration of multiple factors:

Construct Design Strategies:

Construct TypeAdvantagesDisadvantagesBest Applications
Full-length nativePreserves all functional domainsChallenging for structural studiesFunctional assays, native interaction studies
Transmembrane domain truncationsImproved solubilityMay alter catalytic pocket geometryCrystal screens, binding studies
Fusion with crystallization chaperonesEnhanced crystallization propensityPotential interference with functionX-ray crystallography
Thermostabilized variantsImproved stability for structural studiesMay alter native dynamicsCryo-EM, crystallization
Catalytic domain focusSimplified system for mechanism studiesLoss of membrane contextActive site characterization

Critical Design Elements:

  • Terminal tag placement:

    • N-terminal tags less likely to interfere with catalytic activity

    • Consider TEV or PreScission protease cleavage sites for tag removal

    • Test both His6 and larger fusion tags (MBP, SUMO) for improved behavior

  • Transmembrane domain considerations:

    • Identify precise boundaries using topology prediction algorithms

    • Consider partial truncations retaining essential transmembrane helices

    • Design constructs with varying N-terminal truncations (Δ1-20, Δ1-40, Δ1-60)

  • Catalytic residue management:

    • Preserve all conserved catalytic aspartate residues

    • Consider conservative mutations (D→N) for mechanistic studies

    • Maintain substrate-binding pocket residues identified through homology modeling

  • Surface engineering:

    • Identify and modify surface-exposed cysteine residues to prevent disulfide formation

    • Consider surface entropy reduction mutations for crystallization

    • Design constructs with reduced surface hydrophobicity in exposed regions

Experimental Validation Pipeline:

  • Small-scale expression screening of multiple constructs

  • Thermostability assays to identify most stable variants

  • Size-exclusion chromatography to assess monodispersity

  • Activity assays to confirm functional integrity

  • Pilot crystallization or cryo-EM screening to evaluate structural potential

These design principles draw on successful approaches used for other challenging membrane proteins while addressing the specific characteristics of bacterial lipoprotein signal peptidases. For E. tasmaniensis lspA specifically, comparison with genomic data from related Erwinia species can inform rational construct design by identifying conserved structural elements across the genus .

How has E. tasmaniensis lspA evolved compared to homologs in pathogenic Erwinia species, and what does this reveal about bacterial adaptation?

Evolutionary analysis of lspA across Erwinia species provides important insights into bacterial adaptation:

Sequence Evolution Patterns:

  • Core catalytic domains show >90% amino acid conservation across pathogenic and non-pathogenic Erwinia

  • Membrane-spanning regions display higher conservation than surface-exposed loops

  • Substrate-binding regions show evidence of positive selection in pathogenic species

  • E. tasmaniensis lspA retains ancestral-like features compared to specialized pathogen variants

Genomic Context Evolution:

  • Gene neighborhood analysis reveals conservation of core processing machinery

  • Pathogenic species show integration of mobile genetic elements near lspA in some strains

  • Different co-evolutionary patterns with substrate lipoproteins in pathogenic vs. non-pathogenic species

  • Regulatory element divergence suggests differential expression control mechanisms

Selection Pressure Analysis:

  • Purifying selection dominates catalytic domains across all Erwinia species

  • Pathogenic species show evidence of positive selection in substrate recognition regions

  • E. tasmaniensis lspA exhibits relaxed selection in certain surface-exposed regions

  • Residues interacting with specific lipoproteins show lineage-specific conservation patterns

Functional Implications:

  • E. tasmaniensis lspA likely processes a broader range of substrates than pathogen variants

  • Pathogen-specific lspA adaptations correlate with virulence-related lipoprotein specialization

  • E. tasmaniensis enzyme appears optimized for epiphytic lifestyle requirements

  • Divergence in substrate specificity aligns with the acquisition or loss of specific lipoproteins

These evolutionary patterns suggest that while the core enzymatic function of lspA is conserved across the Erwinia genus, subtle adaptations have occurred during the divergence of pathogenic and non-pathogenic lineages. The epiphytic lifestyle of E. tasmaniensis appears to have influenced the evolution of its lipoprotein processing machinery differently than in pathogenic species, reflecting the distinct ecological niches these bacteria occupy on plant surfaces .

What insights can be gained by comparing the substrate specificity of E. tasmaniensis lspA with that of other bacterial signal peptidases?

Comparative substrate specificity analysis reveals important functional distinctions between E. tasmaniensis lspA and other bacterial signal peptidases:

Lipobox Motif Recognition:

  • E. tasmaniensis lspA recognizes canonical bacterial lipobox motifs (L-[A/S]-[G/A]-C)

  • Shows higher tolerance for variations at -3 position compared to E. coli lspA

  • Demonstrates distinct preference patterns compared to pathogenic Erwinia species

  • Maintains broader substrate recognition than highly specialized signal peptidases

Substrate Profile Comparison:

Enzyme SourcePreferred Lipobox MotifTolerance for VariationNotable Features
E. tasmaniensis lspAL-[A/S/V]-[G/A]-CHigh at -3 positionProcesses plant-interaction lipoproteins efficiently
E. amylovora lspAL-[A/S]-[G/A]-CModerateOptimized for pathogenesis-related lipoproteins
E. coli lspAL-[A/S]-G-CLowStringent recognition patterns
P. aeruginosa lspAL-[A/S/T]-[G/A]-CModerateAdapted for diverse environmental conditions
B. subtilis lspAI/L-[A/S]-G-CModerateGram-positive specific features

Signal Peptide Length and Composition:

  • E. tasmaniensis lspA processes signal peptides of varying lengths (15-30 amino acids)

  • Shows preference for hydrophobic core regions with moderate hydrophobicity

  • Demonstrates less stringent charge requirements in n-region compared to E. coli enzyme

  • Efficiently processes plant-environment-specific signal sequences

Molecular Basis for Specificity Differences:

  • Structural modeling indicates variations in S1-S4 binding pockets

  • Surface charge distribution differences correlate with substrate preferences

  • Loop regions connecting transmembrane domains show highest divergence

  • Active site architecture conserved but substrate channel exhibits species-specific features

These substrate specificity comparisons provide valuable insights into how signal peptidases have evolved to process distinct sets of lipoproteins in different bacterial species. The patterns observed in E. tasmaniensis lspA likely reflect adaptations to its epiphytic lifestyle on plant surfaces, where it processes a different complement of lipoproteins compared to pathogenic relatives .

How does the genetic context of lspA in E. tasmaniensis contribute to our understanding of protein secretion system evolution in plant-associated bacteria?

The genomic context of lspA in E. tasmaniensis provides valuable insights into the evolution of bacterial protein secretion systems:

Genomic Organization Analysis:

  • In E. tasmaniensis, lspA is located in a conserved region involved in lipoprotein processing

  • Gene neighborhood typically includes diacylglycerol transferase (lgt) and lipoprotein N-acyltransferase (lnt)

  • This genomic organization differs from pathogenic Erwinia, where mobile genetic elements have altered synteny

  • Comparative genomics reveals conservation of this arrangement across non-pathogenic plant-associated bacteria

Secretion System Integration:

  • E. tasmaniensis lspA processes lipoproteins associated with Type II secretion systems

  • Unlike pathogenic Erwinia, E. tasmaniensis lacks a complete Type III secretion system (T3SS)

  • The absence of T3SS correlates with different evolutionary pressures on lipoprotein processing

  • Type VI secretion system (T6SS) components in E. tasmaniensis show distinct evolutionary patterns compared to pathogenic relatives

Evolutionary Implications:

  • The lspA genetic context in E. tasmaniensis represents an ancestral arrangement

  • Pathogenic Erwinia species show evidence of genomic rearrangements around secretion-related genes

  • The acquisition of T3SS in pathogenic species created evolutionary pressure for specialized lipoprotein processing

  • E. tasmaniensis retained broader substrate specificity without the specialized secretion demands of pathogens

Functional Correlations:

  • Different exopolysaccharide production systems between E. tasmaniensis (cps) and pathogenic Erwinia (ams) influence the lipoprotein landscape

  • Biofilm formation mechanisms differ, affecting the complement of lipoproteins requiring processing

  • Divergent plant interaction strategies correlate with different secretion system requirements

  • Plasmid content variations between species affect the genetic mobility of secretion components

What emerging technologies could advance our understanding of E. tasmaniensis lspA structure and function?

Several cutting-edge technologies show promise for advancing E. tasmaniensis lspA research:

Cryo-Electron Microscopy Advances:

  • Single-particle cryo-EM for membrane protein structure determination without crystallization

  • Improved detectors and processing algorithms enabling resolution below 3Å for membrane proteins

  • Time-resolved cryo-EM to capture different conformational states during catalysis

  • In situ structural studies of lspA within membrane environments using cryo-electron tomography

Integrative Structural Biology Approaches:

  • Combining hydrogen-deuterium exchange mass spectrometry with computational modeling

  • Integrating crosslinking mass spectrometry data with molecular dynamics simulations

  • Employing solid-state NMR to study lspA dynamics in native-like membrane environments

  • Using small-angle X-ray scattering to analyze conformational ensembles in solution

Advanced Functional Analysis Methods:

  • Single-molecule enzymology to observe real-time lspA catalytic events

  • Nanodiscs and lipid cubic phase technologies for stabilizing membrane proteins

  • Microfluidic platforms for high-throughput screening of substrate specificity

  • Native mass spectrometry to study intact enzyme-substrate complexes

Genetic and Genomic Technologies:

  • CRISPR interference for precise modulation of lspA expression in native context

  • Ribosome profiling to identify full complement of lspA substrates

  • Transposon sequencing to map genetic interactions of lspA in vivo

  • Single-cell transcriptomics to analyze lspA expression heterogeneity during plant colonization

These emerging technologies could overcome many of the current limitations in studying membrane-associated enzymes like lspA, providing unprecedented insights into their structure, function, and biological roles. Particularly promising is the potential for integrating structural approaches with in vivo studies to understand how lspA contributes to E. tasmaniensis adaptation to plant surfaces .

What are the potential applications of recombinant E. tasmaniensis lspA in biotechnology and agricultural research?

Recombinant E. tasmaniensis lspA offers diverse applications in biotechnology and agriculture:

Enzyme Technology Applications:

  • Development of novel protein expression systems optimized for secreted recombinant proteins

  • Creation of engineered bacterial strains with enhanced protein secretion capabilities

  • Design of biosensors using lspA-substrate interactions for detecting bacterial contamination

  • Production of enzyme variants with altered substrate specificity for biotechnological processes

Agricultural Biocontrol Development:

  • Engineering E. tasmaniensis strains with optimized colonization properties as biocontrol agents

  • Creating modified lspA variants to enhance survival and persistence on plant surfaces

  • Developing bacterial consortia with complementary lipoprotein processing capabilities

  • Designing plant probiotics with enhanced abilities to exclude pathogenic Erwinia species

Drug Discovery Platform:

  • High-throughput screening for novel lspA inhibitors as potential antibacterials

  • Structure-based design of specific inhibitors for pathogenic Erwinia lspA

  • Development of targeted approaches to disrupt bacterial colonization without broad antibiotics

  • Creation of screening systems to identify plant compounds that modulate bacterial lipoprotein processing

Plant Protection Strategies:

  • Engineering crop plants to express modulators of bacterial lipoprotein processing

  • Developing sprays containing recombinant lspA inhibitors for pathogen management

  • Creating diagnostic tools based on lspA activity to detect early stages of bacterial infections

  • Designing precision biocontrol approaches targeting specific bacterial populations

These applications leverage the fundamental understanding of E. tasmaniensis lspA to develop practical solutions for agriculture and biotechnology. The non-pathogenic nature of E. tasmaniensis makes it particularly suitable as a platform for developing environmentally friendly approaches to plant protection and bacterial management .

What unexplored aspects of E. tasmaniensis lspA function warrant investigation in the context of plant-microbe interactions?

Several unexplored aspects of E. tasmaniensis lspA function in plant-microbe interactions merit further investigation:

Plant Immune Response Interactions:

  • How does lipoprotein processing by lspA influence recognition by plant pattern recognition receptors?

  • Do processed lipoproteins from E. tasmaniensis elicit different immune responses compared to pathogenic Erwinia?

  • Can modifications to lspA processing alter the plant perception of bacterial colonization?

  • What role do lspA-processed lipoproteins play in immune evasion or tolerance induction?

Interspecies Bacterial Interactions:

  • How does E. tasmaniensis lspA contribute to competitive fitness against other plant-associated microbes?

  • Do secreted factors processed by lspA influence microbial community composition on plant surfaces?

  • What role does lipoprotein processing play in bacterial cooperation or antagonism in the phyllosphere?

  • How do lipoproteins from E. tasmaniensis influence pathogenic Erwinia species during co-colonization?

Environmental Adaptation Mechanisms:

  • How does lspA activity respond to changing environmental conditions on plant surfaces?

  • What role do processed lipoproteins play in adaptation to diurnal cycles and seasonal changes?

  • How does lipoprotein processing contribute to stress tolerance in different plant microenvironments?

  • What functions do lspA-processed proteins serve in bacterial dormancy and resuscitation?

Signaling Network Integration:

  • How does lspA-mediated processing integrate with other bacterial signaling networks like c-di-GMP?

  • What role does lipoprotein processing play in quorum sensing and population-level behaviors?

  • How do processed lipoproteins contribute to biofilm initiation and maturation?

  • What is the relationship between lspA activity and cyclic dinucleotide signaling in E. tasmaniensis?

These research directions would significantly advance our understanding of E. tasmaniensis ecology and plant-microbe interactions, potentially revealing new strategies for managing plant microbiomes and developing sustainable approaches to crop protection. The comparative analysis with pathogenic Erwinia species would be particularly valuable for understanding the molecular basis of different plant colonization strategies .

How has our understanding of E. tasmaniensis lspA evolved over time, and what are the key remaining questions?

The scientific understanding of E. tasmaniensis lipoprotein signal peptidase (lspA) has progressed significantly, though important questions remain. Initial characterization focused primarily on gene identification and basic function prediction through homology with other bacterial signal peptidases. As genomic comparisons between pathogenic and non-pathogenic Erwinia species advanced, researchers began exploring the evolutionary trajectory of lspA and its role in bacterial adaptation to different lifestyles.

Recent research has highlighted the importance of lipoprotein processing in bacterial physiology, particularly in the context of plant-microbe interactions. Studies have demonstrated that lipoprotein maturation impacts multiple cellular processes including membrane integrity, protein secretion, biofilm formation, and stress responses. The genomic context analysis across Erwinia species has revealed how lspA evolution correlates with the acquisition or loss of virulence determinants and secretion systems.

Key remaining questions include: (1) the precise three-dimensional structure of E. tasmaniensis lspA and how it differs from pathogenic homologs; (2) the complete substrate profile and specificity determinants; (3) the regulatory mechanisms controlling lspA expression under different environmental conditions; (4) the specific contributions of lspA-processed lipoproteins to plant colonization and bacterial community interactions; and (5) the potential applications of E. tasmaniensis lspA in biotechnology and agricultural management strategies.

Addressing these questions will require integrative approaches combining structural biology, biochemistry, genetics, and ecological studies. Such research promises to enhance our understanding of bacterial adaptation and provide new tools for managing plant-microbe interactions .

What are the major implications of E. tasmaniensis lspA research for understanding bacterial adaptation and plant-microbe interactions?

Research on E. tasmaniensis lspA has far-reaching implications for our understanding of bacterial adaptation and plant-microbe interactions. First, it provides a window into the molecular mechanisms underlying the divergence between pathogenic and non-pathogenic bacterial lifestyles. The epiphytic nature of E. tasmaniensis represents an important ecological niche on plant surfaces, and understanding how lipoprotein processing contributes to this lifestyle helps elucidate the fundamental principles of bacterial adaptation to plant environments.

Second, comparative analyses between E. tasmaniensis and pathogenic Erwinia species highlight how protein processing systems have evolved in conjunction with virulence determinants. The differing exopolysaccharide production systems (cps in E. tasmaniensis versus ams in pathogenic species) and secretion system complement (lack of T3SS in E. tasmaniensis) correlate with specific adaptations in lipoprotein processing machinery, revealing co-evolutionary patterns in bacterial genome organization .

Third, this research addresses fundamental questions about bacterial cell envelope biogenesis and homeostasis. Lipoprotein signal peptidases play critical roles in membrane protein localization and function, impacting cellular processes ranging from nutrient acquisition to stress responses. Understanding these mechanisms in plant-associated bacteria provides insights into how microbes survive in the challenging environment of plant surfaces.

Finally, E. tasmaniensis lspA research has practical implications for agricultural management strategies. As a non-pathogenic relative of important plant pathogens, E. tasmaniensis has potential as a biocontrol agent. Understanding its colonization mechanisms could inform the development of novel approaches to plant protection and microbiome engineering, contributing to sustainable agricultural practices .

How might future discoveries about E. tasmaniensis lspA advance both fundamental microbiology and applied biotechnology?

Future discoveries about E. tasmaniensis lspA hold promise for advancing both fundamental microbiology and applied biotechnology in several key areas:

In fundamental microbiology, deeper insights into E. tasmaniensis lspA will enhance our understanding of bacterial membrane biogenesis, protein secretion mechanisms, and cell envelope homeostasis. Structural characterization of the enzyme will illuminate the molecular basis of substrate recognition and catalysis, potentially revealing conserved principles across bacterial signal peptidases. Comparative studies across Erwinia species will continue to shed light on how essential cellular processes evolve during adaptation to different ecological niches, providing a model for studying bacterial evolution and specialization.

From a plant-microbe interaction perspective, further research will clarify how bacterial lipoprotein processing influences colonization dynamics, microbiome assembly, and plant immune responses. Understanding these interactions at the molecular level could reveal new paradigms in plant-microbe communication and symbiosis establishment. The role of processed lipoproteins in bacterial competition and cooperation within plant microbiomes represents an exciting frontier in microbial ecology research.

In applied biotechnology, E. tasmaniensis lspA discoveries will enable the development of novel protein expression systems with enhanced secretion capabilities. Engineered signal peptidase variants could improve recombinant protein production by optimizing processing efficiency and specificity. The enzyme could serve as a template for designing new tools for protein engineering and synthetic biology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.