Recombinant Erwinia tasmaniensis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

General Properties of NADH-Quinone Oxidoreductase Subunit A

NADH-quinone oxidoreductase subunit A, encoded by the gene nuoA, is part of the NDH-1 complex in bacteria. This complex is simpler than its mammalian counterpart, complex I, but performs a similar function: it shuttles electrons from NADH to quinones via flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers . The enzyme is located in the inner membrane of bacterial cells and is a multi-pass membrane protein .

Function and Mechanism

The primary function of NADH-quinone oxidoreductase is to couple the electron transfer from NADH to quinones with the translocation of protons across the membrane. This process conserves energy in the form of a proton gradient, which is used by ATP synthase to produce ATP . The subunit A (nuoA) is integral to this process, although its specific role within the complex is less well-defined compared to other subunits like PSST in mitochondrial complex I .

Research Findings and Studies

While specific studies on the recombinant Erwinia tasmaniensis NADH-quinone oxidoreductase subunit A are not readily available, research on similar bacterial systems provides valuable insights. For instance, the bacterial NDH-1 complex, similar to complex I in mitochondria, is sensitive to inhibitors like rotenone and piericidin A, which target specific subunits involved in electron transfer . The PSST subunit in mitochondrial complex I and its bacterial counterpart NQO6 have been identified as key components in electron transfer to quinone .

Comparison with Other Organisms

In bacteria like Escherichia coli, the NDH-1 complex is composed of multiple subunits, including NuoA, and is essential for anaerobic respiration using alternative electron acceptors . The subunit composition and function of NDH-1 in different bacteria can vary, but the core mechanism of electron transfer and proton pumping remains conserved.

Data Tables

Given the lack of specific data on the recombinant Erwinia tasmaniensis NADH-quinone oxidoreductase subunit A, we can provide a general overview of the subunit composition of NDH-1 in a well-studied organism like Escherichia coli:

SubunitFunction/Role
NuoAMembrane subunit involved in electron transfer
NuoBConnects soluble and membrane components
NuoCContains iron-sulfur clusters
NuoDPart of the membrane arm
NuoEElectron input part of the complex
NuoFElectron input part; contains FMN
NuoGElectron input part
NuoHMembrane subunit
NuoIConnects soluble and membrane components
NuoJMembrane subunit
NuoKMembrane subunit
NuoLMembrane subunit; may function as a Na+/H+ antiporter
NuoMMembrane subunit
NuoNMembrane subunit

References ECMDB. NADH-quinone oxidoreductase subunit A (P0AFC3). PNAS. NADH-quinone oxidoreductase: PSST subunit couples electron transfer from iron–sulfur cluster N2 to quinone. PMC. Four New Iridoid Metabolites Have Been Isolated from the Stems of Neonauclea reticulata (Havil.) Merr. with Anti-Inflammatory Activities on LPS-Induced RAW264.7 Cells. MetaCyc. NADH:quinone oxidoreductase I, peripheral arm. Nature. Cryo-EM structures of Na+-pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae. PMC. Assessment of the Potential Biological Activity of Low Molecular Weight Metabolites of Freshwater Macrophytes with QSAR. BioCyc. Escherichia coli K-12 substr. MG1655 NADH:quinone oxidoreductase subunit F.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA; ETA_12040; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
nuoA
Target Protein Sequence
MSTTTEVVAHHWAFAVFLIVSIGLCCLMLAGAWFLGGKARGRHTNTPFESGIASVGTAKL RLSAKFYLVAMFFVIFDVEALYLYAWSTAIRESGWVGFVEAAIFILVLLAGLFYLVRIGA LDWAPARRQFDVKPTTISHANRQKP
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.