Recombinant Erwinia tasmaniensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life is influenced by storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; ETA_12130; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGVTIRRNLLFMLIGLEIMINAAALAFVVAGSYWGQADGQV MFILAISLAAAEASIGLALLLQLHRRSQNLNIDKVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This process is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of NADH-quinone oxidoreductase subunit K (nuoK) in Erwinia tasmaniensis?

NADH-quinone oxidoreductase subunit K (nuoK) functions as an integral membrane component of Complex I in the respiratory chain of Erwinia tasmaniensis. This subunit plays a crucial role in proton translocation across the membrane during electron transfer from NADH to quinones. Similar to its homologs in other bacterial species, nuoK contains multiple transmembrane helices that form part of the membrane domain of the complex. The protein likely participates in creating the proton channel that couples electron transfer to proton pumping, thereby contributing to the generation of proton motive force used for ATP synthesis. The mechanism shares conceptual similarities with the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) systems, though with distinct ion specificity and structural organization .

How does nuoK relate to other NADH-quinone oxidoreductase subunits within the complex?

NuoK functions as part of an intricate multisubunit complex where subunit interactions are essential for proper assembly and function. Similar to the organization seen in Rnf complexes, the removal or mutation of one subunit often affects the stability of others, indicating tight structural interdependence . In these electron transport complexes, membrane-integral subunits like nuoK typically interact with both membrane-associated and soluble peripheral subunits. The nuoK subunit likely interfaces with other membrane subunits to form the transmembrane proton channel, while also maintaining structural contacts with peripheral subunits involved in electron transfer. Based on studies of related complexes, nuoK stability would depend on the presence of other subunits, and conversely, its absence would potentially destabilize the entire complex structure .

What evolutionary relationships exist between E. tasmaniensis nuoK and homologous proteins?

E. tasmaniensis nuoK belongs to a highly conserved family of proteins present in the NADH-quinone oxidoreductase complex across diverse bacterial species. Evolutionary analyses would likely reveal conservation patterns similar to those observed in other bacterial respiratory enzymes, where functional domains exhibit higher conservation than connecting regions. The organization of genes encoding NADH-quinone oxidoreductase can vary across species, as observed with the related Rnf complex genes, where different arrangements exist across bacterial and archaeal species . For instance, in some bacteria like Serratia proteamaculans and Yersinia species, related gene clusters show distinctive organizational patterns with intervening regulatory genes . This evolutionary diversity reflects adaptation to different ecological niches while maintaining the core function of electron transport.

What analytical techniques are most suitable for detecting nuoK expression in bacterial cultures?

Detection of nuoK expression requires specific approaches due to its membrane-integral nature. Western blotting using antibodies raised against the recombinant nuoK protein represents the most direct method, though cross-reactivity testing is essential due to the potential sequence similarity with homologous proteins in the expression system. RT-PCR provides an alternative approach for monitoring gene expression at the mRNA level. For both approaches, proper controls are crucial, including comparison with wild-type expression levels and verification against knockout strains.

For proteomic analysis, membrane fraction enrichment followed by detergent solubilization (such as with dodecyl maltoside as used for the Na+-NQR complex ) and liquid chromatography-mass spectrometry (LC-MS/MS) can identify nuoK along with other membrane proteins. Targeted proteomics approaches, such as selected reaction monitoring (SRM), can provide quantitative data on nuoK expression levels across different growth conditions. For functional verification, complementation studies using nuoK-deficient mutants can confirm the biological activity of the expressed protein.

What expression systems yield optimal production of recombinant E. tasmaniensis nuoK?

Optimizing recombinant expression of E. tasmaniensis nuoK requires consideration of its membrane-integral nature. Based on approaches used for similar proteins, several expression systems warrant consideration:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli BL21(DE3)Well-established, economical, rapid growthPotential toxicity, inclusion body formationUse of C41/C43 strains specialized for membrane proteins
E. coli Lemo21(DE3)Tunable expression, reduced toxicitySlower growth than BL21Requires L-rhamnose titration for optimization
Homologous expression in ErwiniaNative membrane environmentLimited genetic toolsConsider approach used for V. cholerae NQR with P(BAD) promoter
Cell-free systemsAvoids toxicity issuesLower yields, expensiveRequires supplementation with lipids/detergents

For membrane proteins like nuoK, fusion tags can significantly improve expression and purification. A C-terminal His6-tag strategy, similar to that employed for NqrF in Vibrio cholerae , could facilitate purification while minimizing interference with membrane insertion. Expression temperature optimization is critical, with lower temperatures (16-25°C) often favoring proper folding of membrane proteins. The use of specialized media formulations, such as terrific broth supplemented with glucose to prevent leaky expression, can further enhance yields. For functional studies, co-expression with other complex subunits may be necessary to ensure proper assembly and stability.

How can site-directed mutagenesis elucidate the functional mechanism of nuoK?

Site-directed mutagenesis represents a powerful approach for investigating the functional residues within nuoK. Based on approaches used for related proteins, a systematic mutagenesis strategy might include:

  • Conservation-guided targeting: Align nuoK sequences across diverse bacterial species to identify highly conserved residues likely essential for function or structure. Prioritize these for initial mutagenesis studies.

  • Transmembrane domain analysis: Target charged residues within predicted transmembrane helices, as these often play critical roles in proton translocation. Mutations of these residues to alanine or residues with similar size but different chemical properties (e.g., glutamate to glutamine) can reveal their functional importance.

  • Interface residues: Based on structural predictions or homology models, identify residues likely to interact with other subunits. Mutations at these positions can disrupt complex assembly, providing insights into intersubunit interactions.

  • Systematic alanine scanning: For regions of unknown function, systematic replacement of consecutive residues with alanine can identify functionally important segments.

Each mutant should be characterized for expression level, complex assembly, and functional activity. For activity assessment, reconstitution into proteoliposomes and measurement of NADH oxidation rates coupled with proton translocation would provide comprehensive functional data. This approach parallels methods used to study the sodium transport function of the Rnf complex , where specific inhibitors and ion transport assays revealed crucial mechanistic details.

What purification strategies yield highest activity retention for recombinant nuoK?

Purification of functional recombinant nuoK presents significant challenges due to its hydrophobic nature and complex integration. An optimized purification workflow would include:

  • Membrane fraction isolation: Following cell disruption, differential centrifugation separates membrane fractions enriched in nuoK.

  • Detergent solubilization: Critical selection of appropriate detergents is essential. For related complexes, dodecyl maltoside (DM) has proven effective in maintaining native cofactor binding and activity . Comparison of multiple detergents (LDAO, DDM, Triton X-100) at varying concentrations is advisable to identify optimal solubilization conditions.

  • Affinity chromatography: If expressing nuoK with a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides effective initial purification. Careful optimization of imidazole concentrations in washing and elution buffers minimizes non-specific binding while maximizing recovery.

  • Size exclusion chromatography: This final purification step resolves aggregates and contaminating proteins while allowing buffer exchange to conditions optimal for downstream applications.

Throughout the purification process, activity assays should monitor retention of functional properties. For NADH:quinone oxidoreductases, NADH consumption rates serve as a reliable activity indicator, with turnover numbers up to 720 electrons per second observed for related enzymes . Additionally, for membrane proteins like nuoK, inclusion of phospholipids or lipid nanodiscs in the final preparation can enhance stability and activity by providing a native-like membrane environment.

How does the membrane topology of nuoK influence its function in bacterial energy metabolism?

The membrane topology of nuoK critically influences its function in energy transduction. Based on studies of related membrane subunits, nuoK likely contains multiple transmembrane helices that contribute to forming the proton translocation pathway across the membrane. The transmembrane domain organization can be experimentally determined through several complementary approaches:

  • Computational prediction: Hydropathy analysis using algorithms like TMHMM, HMMTOP, and Phobius can provide initial predictions of transmembrane helix number and orientation.

  • Cysteine scanning mutagenesis: Introduction of cysteine residues at predicted loop regions, followed by accessibility studies with membrane-impermeable sulfhydryl reagents, can experimentally verify topology models.

  • Reporter fusion analysis: Construction of fusion proteins with reporters like alkaline phosphatase or GFP at various positions can indicate which regions face the cytoplasmic or periplasmic space.

The functional significance of this topology relates to the mechanism of energy coupling. Charged residues positioned within transmembrane helices often participate directly in proton transfer, while interfacial residues may coordinate with other subunits to maintain the integrity of the proton translocation pathway. Similar to the organization observed in Rnf complexes , the transmembrane arrangement likely facilitates electron transfer between cofactors positioned at different membrane depths while simultaneously enabling proton movement across the membrane barrier.

What are the kinetic parameters of reconstituted NADH-quinone oxidoreductase containing recombinant nuoK?

Determining the kinetic parameters of reconstituted NADH-quinone oxidoreductase requires integration of nuoK into the complete multisubunit complex. Based on methodologies used for related complexes, a comprehensive kinetic characterization would include:

ParameterExperimental ApproachExpected RangeInfluencing Factors
Km for NADHUV-Vis spectroscopy measuring NADH oxidation rate at varying concentrations5-50 μMpH, ionic strength, temperature
Km for quinoneVaried quinone concentrations with fixed NADH10-100 μMQuinone hydrophobicity, membrane fluidity
kcatMaximum turnover rate under saturating substrate conditions100-700 s⁻¹Temperature, pH, integrity of complex assembly
pH optimumActivity measurements across pH rangepH 7.0-8.5Buffer composition, protonation states of key residues
Temperature dependenceActivity measurements at varied temperatures to derive activation energyEa: 30-60 kJ/molMembrane fluidity, protein conformational stability
Inhibitor Ki valuesIC50 determination for known Complex I inhibitorsVariableInhibitor mechanism, binding site accessibility

The reconstitution process significantly impacts measured parameters. Proteoliposomes should incorporate physiologically relevant phospholipid compositions, and protein:lipid ratios require optimization to prevent aggregate formation while ensuring sufficient incorporation. Activity assays typically monitor NADH oxidation spectrophotometrically at 340 nm, with rates normalized to protein content. For proton pumping measurements, pH-sensitive fluorescent dyes like ACMA can be incorporated into proteoliposomes to monitor proton translocation coupled to NADH oxidation. Studies of related Na⁺-translocating enzymes have demonstrated that coupling ion (Na⁺ or H⁺) concentration significantly affects kinetic parameters, with up to 5-fold stimulation observed with appropriate ion concentrations .

How can structural studies elucidate the role of nuoK in the complete NADH-quinone oxidoreductase complex?

Structural characterization of nuoK within the complete NADH-quinone oxidoreductase complex requires integrated approaches spanning multiple resolution levels:

  • Cryo-electron microscopy (cryo-EM) represents the most promising technique for resolving the structure of the intact complex including nuoK. Sample preparation should focus on detergent optimization, with screening of multiple detergents to identify those maintaining complex integrity while minimizing preferential orientation on EM grids. Grid preparation techniques such as graphene oxide coating or the addition of specific amphipathic molecules can improve particle distribution and orientation diversity. Data collection strategies should incorporate tilted data acquisition to address preferred orientation issues common with membrane proteins.

  • Crosslinking mass spectrometry (XL-MS) using bifunctional crosslinking reagents followed by proteomic analysis can map interaction interfaces between nuoK and neighboring subunits. This approach provides valuable restraints for structural modeling and can operate at lower resolution than cryo-EM.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of nuoK with differential solvent accessibility, providing insights into membrane-embedded versus exposed regions and potential conformational changes during catalysis.

  • Molecular dynamics simulations using homology models based on related structures can elucidate dynamic aspects of nuoK function, particularly proton translocation pathways and conformational changes associated with electron transfer events.

Integration of these complementary approaches provides a comprehensive structural framework for understanding nuoK's role within the complex. Importantly, structural studies should be coupled with functional assays to correlate structural features with specific aspects of enzyme activity.

What proteomic approaches are most effective for studying post-translational modifications of nuoK?

Post-translational modifications (PTMs) potentially regulate nuoK function and may include phosphorylation, acetylation, or oxidative modifications. An effective proteomic workflow for characterizing these modifications would include:

  • Enrichment strategy: For phosphorylation analysis, metal oxide affinity chromatography (MOAC) using titanium dioxide effectively enriches phosphopeptides. For acetylation, immunoaffinity enrichment with anti-acetyllysine antibodies provides selective isolation.

  • LC-MS/MS analysis: High-resolution mass spectrometry with electron transfer dissociation (ETD) or higher-energy collisional dissociation (HCD) fragmentation optimally preserves and detects labile modifications.

  • Targeted verification: Parallel reaction monitoring (PRM) or selected reaction monitoring (SRM) provide sensitive, quantitative verification of identified PTMs.

  • Site-directed mutagenesis: Converting modified residues to non-modifiable variants (e.g., serine to alanine for phosphorylation sites) enables functional validation of PTM importance.

  • Differential modification mapping: Comparing modification patterns under different growth conditions or in response to specific stressors can reveal regulatory mechanisms.

This proteomic approach can be complemented with specific labeling strategies for particular modifications, such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to quantify modification dynamics or enzyme activity assays to correlate modifications with functional changes.

How can computational approaches predict protein-protein interactions involving nuoK?

Computational prediction of protein-protein interactions involving nuoK requires integration of multiple computational strategies:

  • Homology-based interface prediction: Using structures of homologous complexes as templates for modeling E. tasmaniensis nuoK interactions. This approach leverages the evolutionary conservation of interfaces in related protein complexes.

  • Molecular docking: Generating and scoring potential binding modes between nuoK and other complex subunits using algorithms that account for electrostatic complementarity, shape complementarity, and desolvation effects.

  • Coevolution analysis: Identifying correlated mutations across multiple sequence alignments of nuoK and potential interaction partners. Such correlations often indicate residue pairs in close proximity at protein-protein interfaces.

  • Machine learning approaches: Integrating diverse features (sequence conservation, physicochemical properties, predicted structural features) to classify potential interaction sites based on training sets derived from known membrane protein complexes.

  • Molecular dynamics simulations: Evaluating the stability and dynamics of predicted complexes in explicit membrane environments, providing insights into the energetics and conformational changes associated with complex formation.

Validation of computational predictions should involve experimental techniques such as site-directed mutagenesis of predicted interface residues, crosslinking studies, or pull-down assays to verify predicted interactions. The integration of computational predictions with experimental validation creates an iterative workflow for characterizing the nuoK interactome within the NADH-quinone oxidoreductase complex.

How does nuoK contribute to bacterial adaptation to different environmental conditions?

NADH-quinone oxidoreductase subunit K likely plays a crucial role in bacterial adaptation to changing environmental conditions. Related electron transport complexes show significant functional adaptations to different environmental parameters:

  • Oxygen level adaptation: Under microaerobic or anaerobic conditions, the function of respiratory complexes becomes particularly important. Similar to how the Rnf complex functions in anaerobic bacteria , nuoK may contribute to maintaining energy metabolism when oxygen is limited.

  • pH response: The proton translocation function of nuoK may be modulated by environmental pH, contributing to bacterial pH homeostasis. Structural features like protonatable residues within the membrane domain likely participate in sensing and responding to pH changes.

  • Salt and osmotic stress: Given the role of related complexes in ion translocation, nuoK may contribute to maintaining ion gradients during osmotic challenges. The Na⁺-dependent stimulation observed in some related NADH:quinone oxidoreductases suggests potential roles in ion homeostasis.

  • Nutrient limitation: During energy limitation, efficient function of respiratory complexes becomes critical. Potential post-translational modifications of nuoK might regulate its activity to optimize energy conservation under nutrient-limited conditions.

Research approaches to study these adaptations should include growth studies in defined media with varying environmental parameters, transcriptomic and proteomic profiling to identify regulation patterns, and biochemical characterization of the complex isolated from bacteria grown under different conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.