Recombinant Erwinia tasmaniensis Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Overview

The ArnF protein, specifically the recombinant form from Erwinia tasmaniensis, is a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit . ArnF's primary known function relates to drug resistance, though further research could uncover additional roles .

Function and Role

The ArnF protein is involved in the biosynthesis of lipid A modifications with 4-amino-4-deoxy-L-arabinose (L-Ara4N) . These modifications are crucial for conferring resistance to cationic antimicrobial peptides, like polymyxins, and are important for bacterial survival in hostile environments . ArnF functions as a flippase, translocating L-Ara4N-phosphate from the inner to the outer leaflet of the cytoplasmic membrane, a necessary step in the modification of lipid A .

Biotechnological Applications of Erwinia tasmaniensis

Erwinia tasmaniensis also produces levansucrase (EtLsc), an enzyme with biotechnological interest due to its potential in synthesizing fructosyl glycosides . EtLsc has shown enantiomer selection for (S)-1,2,4-butanetriol and its biochemical characterization suggests the possible application of short aliphatic moieties containing polyols with defined stereocentres in fructosylation biotechnology .

ArnF in Drug Resistance

The arnF protein contributes to drug resistance in bacteria . Modifications of lipid A with L-Ara4N can alter the bacterial cell surface, reducing the binding of antimicrobial peptides and increasing bacterial survival .

Related Research

  • Antimicrobial resistance: Research indicates that enzymes are crucial for bacterial survival and resistance to antimicrobial compounds .

  • Protein Secretion: Type III secretion systems in bacteria like Erwinia and Yersinia recognize mRNA signals to couple translation with polypeptide secretion, highlighting a mechanism for protein export .

  • Enzyme Activity: Studies on Erwinia tasmaniensis levansucrase (EtLsc) reveal its increased efficiency in producing fructooligosaccharides (FOS), making it a valuable catalyst for biotechnological synthesis .

Table: Properties of Recombinant Shewanella Sediminis ArnF Protein

PropertyDescription
SourceShewanella sediminis
TagN-terminal His tag
Amino Acid Range1-145aa
FunctionProbable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit
Primary FunctionDrug resistance

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
arnF; ETA_23770; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
arnF
Target Protein Sequence
MGLLFALGSVVLVSAAQLLLKWAMIQLPDISQLPQFLSSLSQFPLPTAALFLGLLAYALS MLCWLLALKRLPLSRAYPLLSLSYLLVWLAALWLPGLNEVFRWGKLAGAGLIVSGLLLIC WPAAKTR
Uniprot No.

Target Background

Function
This protein functions as a flippase, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia tasmaniensis ArnF and what is its biological function?

ArnF (previously designated as PmrL in some bacterial species) functions as a subunit of the undecaprenyl phosphate-α-L-arabinose flippase complex. This transmembrane protein plays a critical role in the transport of undecaprenyl phosphate-α-L-Ara4N (4-amino-4-deoxy-L-arabinose) across the inner bacterial membrane . The protein's primary function is involved in lipid A modification pathways, which are essential for antimicrobial peptide resistance in several gram-negative bacteria. In Erwinia tasmaniensis, the protein shares significant homology with other bacterial ArnF proteins while maintaining species-specific characteristics .

The flippase complex, of which ArnF is a component, facilitates the translocation of the aminoarabinose moiety from the cytoplasmic to the periplasmic face of the inner membrane, where it can subsequently be transferred to lipid A by ArnT transferase. This modification alters the surface charge of lipopolysaccharide (LPS), reducing the binding affinity of cationic antimicrobial peptides to the bacterial outer membrane .

What expression systems are most effective for recombinant ArnF production?

Recombinant Erwinia tasmaniensis ArnF can be successfully expressed in multiple heterologous systems, each offering distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliHigh yield, rapid growth, cost-effective, simplified purificationLimited post-translational modificationsHighest
YeastProper protein folding, some post-translational modificationsModerate yield, longer expression timeHigh
Insect cellsAdvanced post-translational modifications, proper membrane protein foldingLower yield, complex methodologyModerate
Mammalian cellsComplete post-translational modifications, native-like protein structureLowest yield, most expensive, time-consumingLow

For most basic research applications, E. coli and yeast expression systems provide optimal balance between yield and functionality . The E. coli system is particularly advantageous when high protein quantities are required for structural studies, while yeast systems may better preserve functional aspects of the protein. For comprehensive structure-function analyses requiring properly folded transmembrane domains, insect cell expression systems may be preferable despite their lower yield .

What are the optimal buffer conditions for maintaining ArnF stability during purification?

ArnF purification presents challenges common to membrane proteins. Based on established protocols for similar flippase subunits, the following buffer system has demonstrated optimal stability:

Recommended Purification Buffer System:

  • Base buffer: Tris/PBS-based buffer, pH 8.0

  • Stabilizing agents: 6% Trehalose

  • Storage conditions: Lyophilized powder or aliquoted in buffer with 30-50% glycerol at -20°C/-80°C

  • Reconstitution: Deionized sterile water to 0.1-1.0 mg/mL

The inclusion of trehalose in the buffer formulation is particularly critical as it helps maintain protein stability during freeze-thaw cycles and prevents aggregation of hydrophobic transmembrane domains. Repeated freeze-thaw cycles should be strictly avoided, with working aliquots maintained at 4°C for no more than one week .

For functional studies, detergent selection becomes crucial. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) at concentrations just above their critical micelle concentration (CMC) generally provide optimal solubilization while preserving functional integrity.

How can researchers verify the functional activity of recombinant ArnF in vitro?

Verifying the functional activity of recombinant ArnF requires specialized assays that assess its flippase activity. Since ArnF functions as part of a complex with ArnE, a comprehensive functional assessment should include:

  • Reconstitution Assays: Incorporating purified ArnF and ArnE into liposomes loaded with fluorescently-labeled undecaprenyl phosphate-α-L-Ara4N analogs.

  • Membrane Translocation Assessment: Monitoring the translocation of the labeled substrate from the inner to outer leaflet of the liposome using membrane-impermeable quenching agents.

  • Complementation Studies: Expressing recombinant ArnF in arnF-deficient bacterial strains and assessing restoration of polymyxin resistance.

  • N-hydroxysulfosuccinimidobiotin Labeling: This membrane-impermeable amine reagent can be used to quantify the amount of undecaprenyl phosphate-α-L-Ara4N present on the periplasmic face of the membrane, providing a direct measurement of flippase activity .

A significant reduction in labeling (4-5 fold) with N-hydroxysulfosuccinimidobiotin has been observed in arnE/arnF mutants compared to wild-type strains, making this a reliable indicator of flippase functionality .

How does ArnF contribute to antimicrobial resistance mechanisms in bacteria?

ArnF plays a crucial role in antimicrobial peptide resistance through its participation in lipid A modification pathways. The mechanistic details include:

  • Modification Pathway: The arnBCADTEF operon (previously designated pmrHFIJKLM in some species) encodes enzymes required for the synthesis and addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A.

  • Membrane Transport: ArnE and ArnF (previously PmrL and PmrM) function together as components of an undecaprenyl phosphate-α-L-Ara4N flippase that translocates the lipid-linked L-Ara4N precursor from the cytoplasmic to the periplasmic face of the inner membrane .

  • Resistance Mechanism: This modification adds a positively charged amino group to lipid A, reducing the negative charge of the bacterial outer membrane. The resulting electrostatic repulsion decreases binding affinity for cationic antimicrobial peptides like polymyxins .

  • Regulation: Expression of the arn operon is regulated by the PmrA transcription factor, which responds to specific environmental signals including low Mg²⁺, high Fe³⁺, and acidic pH.

Mutational studies have demonstrated that chromosomal inactivation of arnF genes in polymyxin-resistant E. coli strains switches their phenotype to polymyxin-sensitive, confirming the protein's essential role in antimicrobial resistance .

What experimental design approaches are most effective for studying ArnF-substrate interactions?

Studying ArnF-substrate interactions presents significant challenges due to the hydrophobic nature of both the protein and its lipid-linked substrate. Several complementary approaches can be employed:

  • Surface Plasmon Resonance (SPR): By immobilizing ArnF on a sensor chip and flowing various concentrations of undecaprenyl phosphate-α-L-Ara4N in detergent micelles, binding kinetics can be determined. This approach requires careful optimization of detergent conditions to maintain protein stability without interfering with substrate binding.

  • Isothermal Titration Calorimetry (ITC): For direct measurement of binding thermodynamics, though this requires substantial quantities of both purified protein and substrate.

  • Fluorescence-Based Assays: Using fluorescently labeled substrate analogs to monitor binding through changes in fluorescence intensity, anisotropy, or FRET.

  • Photoaffinity Labeling: Employing substrate analogs with photoactivatable groups to covalently capture transient protein-substrate complexes, followed by mass spectrometry analysis.

  • Molecular Dynamics Simulations: Computational approaches can provide insights into potential binding modes and substrate translocation pathways when combined with experimental data.

For robust experimental design, incorporating appropriate controls is essential. These should include:

  • Protein variants with mutations in predicted substrate-binding sites

  • Structurally similar but non-transportable substrate analogs

  • Reconstitution systems with varying lipid compositions to assess environmental effects

How can researchers effectively study the ArnE-ArnF interaction and complex formation?

Understanding the formation and structure of the ArnE-ArnF flippase complex requires specialized approaches for membrane protein complexes:

  • Co-immunoprecipitation: Using tagged versions of ArnE and ArnF to pull down interacting partners from membrane fractions, followed by western blot analysis.

  • Bacterial Two-Hybrid Systems: Adapted for membrane proteins to detect protein-protein interactions in vivo.

  • FRET Analysis: Employing fluorescently labeled ArnE and ArnF to monitor complex formation through fluorescence resonance energy transfer.

  • Co-purification Strategies: Tandem affinity purification with differentially tagged ArnE and ArnF to isolate intact complexes.

  • Crosslinking Mass Spectrometry: Using chemical crosslinkers followed by proteomic analysis to identify interacting regions between ArnE and ArnF.

  • Native Mass Spectrometry: For determination of complex stoichiometry and stability under various conditions.

Analytical ultracentrifugation and size-exclusion chromatography combined with multi-angle light scattering (SEC-MALS) can provide additional information about complex size, shape, and stoichiometry. These approaches should be validated using mutational analysis targeting predicted interaction interfaces .

How does Erwinia tasmaniensis ArnF compare with homologs from other bacterial species?

Erwinia tasmaniensis ArnF shares significant sequence and functional homology with ArnF proteins from other gram-negative bacteria, particularly within the Enterobacteriaceae family. Comparative analysis reveals:

SpeciesSequence Identity (%)Key Functional DifferencesResistance Profile
Erwinia tasmaniensis100 (reference)Non-pathogenic isolateModerate resistance
Escherichia coli70-75Well-characterized role in polymyxin resistanceHigh resistance when induced
Salmonella typhimurium68-72First characterized as PmrLHigh constitutive resistance
Salmonella paratyphi A68-70Partial characterization availableModerate to high resistance

Erwinia tasmaniensis was first isolated from flowers and bark of apple and pear trees in Australia (Victoria, Tasmania, and Queensland), and characterized as a non-phytopathogenic bacterium . While the bacterium itself is not pathogenic to plants, the conservation of ArnF across bacterial species suggests its fundamental importance in bacterial membrane biology beyond pathogenesis.

How has the methodology for studying ArnF evolved over time?

The methodological approaches for studying ArnF and related flippase proteins have evolved considerably:

Historical Progression:

  • Early Studies (2000-2007): Initial identification and characterization using genetic approaches. Chromosomal inactivation studies established the role of ArnF (then called PmrL) in polymyxin resistance. Primary methods included genetic complementation and basic phenotypic assays .

  • Functional Characterization (2007-2015): Development of biochemical assays to study flippase activity. Introduction of N-hydroxysulfosuccinimidobiotin labeling techniques to quantify substrate translocation. Establishment of in vitro reconstitution systems .

  • Protein Production Advances (2015-2020): Optimization of expression systems for membrane proteins, including specialized E. coli strains, insect cell systems, and detergent screening protocols. Improvements in purification strategies for hydrophobic membrane proteins .

  • Current Approaches (2020-Present): Integration of structural biology techniques (cryo-EM, X-ray crystallography) with advanced functional assays. Implementation of native mass spectrometry and hydrogen-deuterium exchange mass spectrometry (HDX-MS) to study protein dynamics. Application of bibliometric analysis tools to track research trends and identify knowledge gaps .

The evolution of these methods has enabled increasingly sophisticated investigations of ArnF structure, function, and interactions, moving from simple genetic studies to integrated structural and functional analyses that provide mechanistic insights at the molecular level.

What are the current challenges and future perspectives in studying ArnF and related flippases?

Several significant challenges remain in the study of ArnF and related flippase proteins:

  • Structural Determination: Despite advances in membrane protein structural biology, obtaining high-resolution structures of ArnF alone or in complex with ArnE remains challenging. Future research should focus on leveraging cryo-EM techniques optimized for small membrane proteins.

  • Substrate Specificity: The precise molecular determinants of substrate recognition by ArnF are not fully understood. Development of substrate analogs with varying structural features could help elucidate specificity determinants.

  • Complex Assembly and Stoichiometry: The composition and stoichiometry of the functional ArnE-ArnF complex require further investigation, particularly regarding the potential involvement of additional components.

  • Regulatory Mechanisms: While the transcriptional regulation of arnF by PmrA is established, potential post-translational regulatory mechanisms remain unexplored.

Future research directions with significant potential include:

  • Structure-Based Drug Design: Once structural information becomes available, rational design of compounds targeting the ArnE-ArnF complex could lead to novel adjuvants that sensitize resistant bacteria to antimicrobial peptides.

  • Synthetic Biology Applications: Engineered ArnF variants with altered substrate specificity could potentially be used in synthetic biology applications for the modification of bacterial cell surfaces.

  • Systems Biology Integration: Incorporating ArnF function into comprehensive models of bacterial envelope biogenesis and stress response pathways.

  • Evolutionary Analysis: Comparative genomics and phylogenetic analysis across diverse bacterial species could reveal evolutionary patterns and functional adaptations of ArnF in different ecological niches .

How can advanced data analytics approaches enhance research on ArnF?

Modern data analytics approaches offer powerful tools for advancing ArnF research:

  • Bibliometric Analysis: Systematic review of literature using bibliometric tools can identify research trends, knowledge gaps, and potential collaborations in the field. As demonstrated in other areas, bibliometric analysis can reveal associations between specific data analysis techniques and their applications in different research contexts .

  • Machine Learning for Sequence-Function Relationships: By analyzing sequence variations across homologs with different functional properties, machine learning algorithms can identify residues critical for specific aspects of ArnF function.

  • Molecular Dynamics Simulations: Advanced computational approaches can model ArnF structure, dynamics, and interactions with lipids and substrates, generating testable hypotheses for experimental validation.

  • Network Analysis: Integration of proteomics and genetic interaction data can position ArnF within broader cellular networks, revealing unexpected functional connections.

  • Artificial Intelligence-Based Analytics: Emerging AI approaches can improve experimental design through predictive modeling of protein behavior under various conditions .

Implementation of these advanced analytics approaches requires interdisciplinary collaboration between computational scientists, structural biologists, and microbiologists. Such collaborations will be essential for developing integrated models of ArnF function within bacterial physiology and pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.