Recombinant Erwinia tasmaniensis Probable intracellular septation protein A (ETA_15950)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; ETA_15950; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
ETA_15950
Target Protein Sequence
MKQLLDFLPLVVFFIFYKLYDIFVASGALIVASAIALAVSWLLYRKVEKMALFTFALVAI FGTLTIALHNPDFIKWKVTIIYGLFTLALLFSHWFMQQPLIQKMLGKEIRLPTTAWRRLN IAWALFFLACGLANIYVAFWLSQDTWMNFKVFGLSGLTLLFTLLSGIYIYRLMPQDEK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia tasmaniensis and what is its significance in microbiological research?

Erwinia tasmaniensis is a non-pathogenic bacterium that was first isolated from flowers and bark of apple and pear trees in Australia, specifically in Victoria, Tasmania, and Queensland. It is closely related to pathogenic Erwinia species such as E. amylovora and E. pyrifoliae, which cause fire blight and Asian pear shoot blight, respectively .

The complete genome of the type strain Et1/99 (DSM 17950) consists of a 3.9 Mb circular chromosome and five plasmids . Its significance lies in its non-pathogenic nature despite sharing genomic similarities with plant pathogens, making it an excellent model for comparative genomics studies investigating the evolution of pathogenicity in related species .

Methodologically, researchers can use Erwinia tasmaniensis as a control organism when studying virulence factors in related pathogenic species, as it provides insights into the ancestral genomic background of many plant-associated bacteria .

How does Erwinia tasmaniensis differ genomically from pathogenic Erwinia species?

Genomic analysis reveals several key differences between Erwinia tasmaniensis and pathogenic Erwinia species:

FeatureErwinia tasmaniensisPathogenic Erwinia species (e.g., E. amylovora)
Genome size3.9 Mb chromosome with five plasmidsSimilar size but different genetic organization
Virulence factorsContains some virulence-associated factors but with differences or missing partsComplete suite of virulence factors
Sorbitol operonCompletely lacks the sorbitol operonPresent and critical for virulence in E. amylovora
Type III secretion systemHas the hypersensitive response type III pathwaySimilar system but with functional differences
Metabolic capabilitiesCannot utilize sorbitol, the dominant carbohydrate in rosaceous plantsCan utilize sorbitol, which is crucial for pathogenicity

The most significant difference is the complete absence of the sorbitol operon in E. tasmaniensis, which likely contributes to its inability to invade fire blight host plants. E. amylovora requires sorbitol utilization for virulence, as sorbitol is the dominant carbohydrate in rosaceous plants .

What are the optimal conditions for expressing and purifying recombinant ETA_15950 protein?

For the expression and purification of Recombinant Erwinia tasmaniensis Probable intracellular septation protein A (ETA_15950), the following methodological approach is recommended:

Expression System:

  • Host: E. coli is the preferred expression system as indicated in available recombinant protein products

  • Vector: Expression vectors containing His-tag for ease of purification

  • Promoter: T7 or similar strong inducible promoter systems

Culture Conditions:

  • Media: LB or 2xYT supplemented with appropriate antibiotics

  • Temperature: Initially grow at 37°C until OD600 reaches 0.6-0.8, then reduce to 18-25°C for protein expression

  • Induction: 0.1-0.5 mM IPTG for 4-16 hours at reduced temperature

  • Aeration: Maintain high aeration (200-250 rpm shaking)

Purification Protocol:

  • Cell lysis using sonication or pressure-based methods in a buffer containing 20-50 mM Tris pH 8.0, 150-300 mM NaCl, and mild detergents

  • Affinity chromatography using Ni-NTA or similar matrices

  • Size exclusion chromatography to obtain pure protein

  • Store in a Tris-based buffer with 50% glycerol at -20°C for extended storage

Critical Considerations:

  • As a membrane protein, ETA_15950 requires detergents for solubilization and stability

  • Avoid repeated freeze-thaw cycles as noted in product recommendations

  • For working aliquots, store at 4°C for up to one week

How can researchers evaluate the functional activity of purified ETA_15950 protein?

Evaluating the functional activity of ETA_15950 requires approaches specific to membrane proteins involved in cell division:

Structural Analysis:

  • Circular dichroism (CD) spectroscopy to confirm proper folding and secondary structure

  • Limited proteolysis to assess structural integrity

  • Dynamic light scattering to determine homogeneity

Membrane Association Studies:

  • Liposome binding assays to confirm membrane association properties

  • Fluorescence-based assays to study protein-lipid interactions

  • Detergent solubility profiles to assess membrane protein characteristics

Interaction Studies:

  • Pull-down assays using His-tagged ETA_15950 to identify interaction partners

  • Bacterial two-hybrid systems to confirm specific protein-protein interactions

  • Cross-linking experiments followed by mass spectrometry to map interaction sites

Functional Assays:

  • In vitro septation assays using purified components

  • Fluorescence microscopy with labeled protein to visualize localization patterns

  • Complementation studies in septation-deficient bacterial strains

Each of these approaches provides different but complementary information about the function of ETA_15950, and a combination of methods is typically required for comprehensive functional characterization.

What research design would be appropriate for investigating ETA_15950's role in bacterial adaptation to plant surfaces?

A comprehensive research design to investigate ETA_15950's potential role in bacterial adaptation to plant surfaces should include:

Stage 1: Comparative Genomic Analysis

  • Compare ETA_15950 sequences across multiple Erwinia species with different plant associations

  • Analyze selection pressure on the gene using dN/dS ratios

  • Identify co-evolving genes that may function in related pathways

Stage 2: Gene Expression Studies

  • qRT-PCR analysis of ETA_15950 expression under various conditions:

    • Different plant extract exposures

    • Various growth phases

    • Environmental stress conditions

  • RNA-seq to identify co-regulated genes

Stage 3: Functional Characterization

  • Generate knockout and complemented strains

  • Assess phenotypes related to:

    • Biofilm formation

    • Plant surface attachment

    • Stress resistance

    • Competitive fitness on plant surfaces

Stage 4: Microscopy and Localization

  • Fluorescent protein fusions to visualize ETA_15950 localization during:

    • Growth on different surfaces

    • Cell division stages

    • Plant colonization

Stage 5: Plant Interaction Studies

  • Compare wild-type and mutant strains for:

    • Colonization efficiency on different plant tissues

    • Persistence under varying environmental conditions

    • Competition with other microorganisms

This design incorporates both molecular and ecological approaches to understand how ETA_15950 might contribute to the epiphytic lifestyle of Erwinia tasmaniensis on plant surfaces .

What technical challenges are associated with studying membrane proteins like ETA_15950, and how can researchers overcome them?

Membrane proteins like ETA_15950 present several technical challenges:

Challenge 1: Protein Expression and Purification

  • Low expression levels in heterologous systems

  • Protein aggregation and inclusion body formation

  • Difficulty maintaining native conformation

Solutions:

  • Use specialized expression strains (C41/C43, Lemo21)

  • Employ fusion tags that enhance solubility (MBP, SUMO)

  • Optimize expression conditions (temperature, induction time)

  • Consider cell-free expression systems for toxic proteins

Challenge 2: Structural Characterization

  • Difficulty in obtaining crystals for X-ray crystallography

  • Challenges in NMR studies due to size and detergent micelles

  • Limited resolution in cryo-EM for smaller membrane proteins

Solutions:

  • Screen multiple detergents and lipid-like environments

  • Consider lipidic cubic phase crystallization

  • Use solid-state NMR for membrane-embedded proteins

  • Apply integrative structural biology approaches combining multiple methods

Challenge 3: Functional Analysis in Native Environment

  • Difficulty recreating native membrane environment

  • Complex interaction networks may be disrupted in vitro

  • Physiological relevance of in vitro observations

Solutions:

  • Use nanodiscs or liposomes to mimic native membrane environment

  • Apply in situ approaches like cross-linking mass spectrometry

  • Develop cellular assays that report on protein function

  • Use genetic approaches (complementation, suppressor screening)

These methodological approaches can help overcome the inherent difficulties in studying membrane proteins while maintaining physiological relevance of the findings.

How might researchers investigate the evolutionary conservation of septation proteins like ETA_15950 across different bacterial genera?

Investigating evolutionary conservation of septation proteins requires a multi-faceted approach:

Phylogenetic Analysis:

  • Identify homologs across diverse bacterial phyla using:

    • BLAST and HMM-based searches

    • Profile-based methods for distant homologs

    • Structural prediction-based approaches

  • Construct phylogenetic trees using:

    • Maximum likelihood methods

    • Bayesian inference

    • Distance-based methods for large datasets

Structural Conservation Analysis:

  • Predict secondary and tertiary structures using:

    • AlphaFold or similar structure prediction tools

    • Threading methods for remote homologs

    • Molecular dynamics simulations

  • Compare structural features:

    • Conserved domains and motifs

    • Membrane topology

    • Potential functional sites

Functional Conservation Testing:

  • Conduct cross-species complementation experiments:

    • Can ETA_15950 complement septation defects in other bacteria?

    • Can homologs from other species function in Erwinia?

  • Generate chimeric proteins:

    • Swap domains between homologs to identify functional regions

    • Test in appropriate mutant backgrounds

Genomic Context Analysis:

  • Examine gene neighborhoods across species:

    • Co-occurrence with other cell division genes

    • Conservation of operon structure

    • Horizontal gene transfer events

This comprehensive approach provides insights into both the evolutionary history and functional significance of septation proteins across bacterial diversity.

What methodological approaches can be used to study protein-protein interactions involving ETA_15950 in the context of bacterial cell division?

Studying protein-protein interactions involving membrane proteins like ETA_15950 requires specialized methodological approaches:

In vivo Approaches:

  • Bacterial Two-Hybrid (BTH) Systems

    • BACTH system optimized for membrane proteins

    • Split-ubiquitin systems

    • Advantages: Detects interactions in a cellular context

    • Limitations: May produce false positives/negatives

  • Fluorescence-Based Methods

    • Förster Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence Localization Microscopy

    • Advantages: Visualizes interactions in live cells

    • Limitations: Requires genetic modification, potential artifacts from tags

In vitro Approaches:

  • Co-immunoprecipitation and Pull-down Assays

    • Using anti-ETA_15950 antibodies or His-tag

    • Crosslinking prior to solubilization

    • Advantages: Can identify novel interaction partners

    • Limitations: May disrupt weak interactions during solubilization

  • Surface Plasmon Resonance (SPR) and Bio-Layer Interferometry (BLI)

    • Immobilize purified ETA_15950 on sensor chips with appropriate detergents

    • Test interactions with purified division proteins

    • Advantages: Provides kinetic and affinity data

    • Limitations: Requires purified components, artificial environment

Mass Spectrometry-Based Approaches:

  • Cross-linking Mass Spectrometry (XL-MS)

    • Use membrane-permeable crosslinkers

    • Identify crosslinked peptides by MS/MS

    • Advantages: Captures transient interactions, provides structural constraints

    • Limitations: Complex data analysis, requires specialized expertise

  • Proximity-Based Labeling

    • BioID or APEX2 fusions to ETA_15950

    • Identify proximal proteins by streptavidin pull-down and MS

    • Advantages: Maps protein neighborhoods in native context

    • Limitations: May identify proximal but non-interacting proteins

Each method has specific strengths and limitations; therefore, multiple complementary approaches should be used to build a comprehensive interaction map for ETA_15950.

How does the genomic context of ETA_15950 compare across different Erwinia species, and what might this reveal about its functional evolution?

The genomic context analysis of ETA_15950 across Erwinia species provides valuable insights into its functional evolution:

Comparative Genomic Analysis:

SpeciesETA_15950 Homolog PresentGenomic ContextPathogenicity
Erwinia tasmaniensisYes (reference)Present in chromosomeNon-pathogenic
Erwinia amylovoraHomolog presentSimilar genomic neighborhood but with variationsPathogenic (fire blight)
Erwinia pyrifoliaeHomolog presentSimilar to E. amylovoraPathogenic (Asian pear shoot blight)
Erwinia billingiaeHomolog presentDifferent arrangementEpiphytic, non-pathogenic

Methodological Approach:

  • Identify syntenic regions surrounding ETA_15950 using whole-genome alignment tools

  • Analyze gene order conservation and rearrangements

  • Examine selection pressure on individual genes within the neighborhood

  • Identify co-evolving genes that may functionally interact with ETA_15950

Potential Findings and Implications:

  • Conservation of genomic context would suggest functional constraints and importance

  • Differences in genomic organization between pathogenic and non-pathogenic species might reveal adaptations to different ecological niches

  • Co-evolution with specific genes might indicate functional relationships in cellular processes

Such comparative genomic analyses would be particularly valuable given that Erwinia tasmaniensis shares many genomic features with pathogenic relatives but lacks key virulence determinants like the sorbitol operon .

What research approaches would be most effective for investigating the potential role of ETA_15950 in bacterial stress response?

To investigate ETA_15950's potential role in bacterial stress response, a multi-faceted research approach is recommended:

Stage 1: Expression Analysis Under Stress Conditions

  • qRT-PCR and RNA-seq to measure ETA_15950 expression under:

    • Osmotic stress (NaCl, sorbitol gradients)

    • Oxidative stress (H₂O₂, paraquat)

    • pH stress (acidic and alkaline conditions)

    • Temperature stress (heat shock, cold shock)

    • Plant-derived antimicrobial compounds

  • Promoter-reporter fusions to monitor expression dynamics in real-time

Stage 2: Genetic Manipulation Studies

  • Generate ETA_15950 deletion mutant

  • Create complementation strains (wild-type and site-directed mutants)

  • Construct overexpression strains

  • Assess phenotypes under various stress conditions:

    • Growth curves

    • Survival rates

    • Biofilm formation

    • Cell morphology

Stage 3: Protein-Level Analysis

  • Monitor protein abundance and modifications under stress using:

    • Western blotting

    • Mass spectrometry for post-translational modifications

    • Pulse-chase experiments to assess protein turnover

  • Examine protein localization changes using fluorescent fusion proteins

Stage 4: Systems-Level Analysis

  • Transcriptomics comparing wild-type and mutant strains under stress

  • Metabolomics to identify affected metabolic pathways

  • Protein interaction studies under normal vs. stress conditions

  • Comparative analysis with stress responses in pathogenic Erwinia species

This comprehensive approach would provide insights into whether ETA_15950 contributes to stress adaptation in Erwinia tasmaniensis, potentially explaining its success as an epiphytic bacterium on plant surfaces .

What are the key methodological considerations when designing experiments to study the role of ETA_15950 in bacterial cell division?

Studying ETA_15950's role in bacterial cell division requires carefully designed experiments addressing several methodological considerations:

Genetic Approaches:

  • Clean Deletion Construction

    • Use scarless deletion methods to avoid polar effects

    • Consider conditional mutants if ETA_15950 is essential

    • Create complementation strains with controlled expression

  • Expression Level Control

    • Use inducible promoters with titratable expression

    • Consider native vs. overexpression consequences

    • Monitor protein levels using western blotting

Phenotypic Characterization:

  • Cell Division Parameters

    • Measure growth rates in various media

    • Determine cell size distribution using flow cytometry

    • Quantify division site placement accuracy

    • Assess Z-ring formation using FtsZ-fluorescent protein fusions

  • Microscopy Approaches

    • Phase contrast for basic morphology

    • Fluorescence microscopy with membrane and DNA stains

    • Time-lapse microscopy to observe division dynamics

    • Super-resolution techniques for detailed localization

Interaction Studies:

  • Division Machinery Interactions

    • Test interactions with known division proteins (FtsZ, FtsA, ZipA)

    • Use bacterial two-hybrid assays optimized for membrane proteins

    • Confirm interactions using co-immunoprecipitation

    • Map interaction domains using truncation constructs

  • Localization Studies

    • Create C-terminal and N-terminal fluorescent protein fusions

    • Verify functionality of fusion proteins

    • Use inducible system to avoid artifacts from overexpression

    • Correlate localization with cell cycle stages

Biochemical Approaches:

  • In vitro Reconstitution

    • Purify components of the division machinery

    • Test effects on FtsZ polymerization

    • Assess membrane binding properties

    • Reconstitute minimal division reactions

  • Structural Analysis

    • Define membrane topology using reporter fusions

    • Identify critical residues using site-directed mutagenesis

    • Use structural predictions to guide functional studies

These methodological considerations ensure rigorous investigation of ETA_15950's role in bacterial cell division while minimizing artifacts and misinterpretations that can arise when studying membrane proteins involved in complex cellular processes.

What are the optimal storage and handling conditions for recombinant ETA_15950 protein to maintain its stability and activity?

Based on product specifications and best practices for membrane proteins, the following storage and handling conditions are recommended for recombinant ETA_15950:

Storage Recommendations:

  • For long-term storage: Store at -20°C or -80°C in a Tris-based buffer containing 50% glycerol

  • For working stocks: Maintain aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which can lead to protein denaturation and loss of activity

Buffer Composition:

  • Storage buffer: 20-50 mM Tris-HCl (pH 7.5-8.0), 100-150 mM NaCl, 50% glycerol, with protein-specific optimizations

  • Working buffer: Similar composition but with reduced glycerol (10-20%)

  • Consider adding stabilizing agents:

    • Mild detergents (0.01-0.05% DDM or similar)

    • Reducing agents (1-5 mM DTT or β-mercaptoethanol)

    • Protease inhibitors for sensitive applications

Handling Protocols:

  • Thaw frozen aliquots rapidly at room temperature or 37°C water bath

  • Once thawed, keep on ice during handling

  • Centrifuge briefly before opening tubes to collect condensation

  • Use low-binding microcentrifuge tubes to prevent protein adsorption

  • When diluting, use pre-chilled buffers and mix gently

  • For quantitative work, re-check protein concentration after any freeze-thaw cycle

Stability Monitoring:

  • Periodic verification of integrity using SDS-PAGE

  • Functional assays to confirm activity retention

  • Consider thermal shift assays to optimize buffer conditions

Following these recommendations will help maintain the structural integrity and functional activity of recombinant ETA_15950 protein during storage and experimental procedures.

What bioinformatic tools and databases would be most useful for researchers studying ETA_15950 and related septation proteins?

Researchers studying ETA_15950 and related septation proteins should utilize the following bioinformatic resources:

Sequence Analysis Tools:

  • Basic Analysis

    • BLAST (NCBI): For identifying homologs across different species

    • Clustal Omega: For multiple sequence alignment of homologs

    • MUSCLE: Alternative for multiple sequence alignment with improved accuracy

  • Advanced Sequence Analysis

    • HMMER: For sensitive detection of remote homologs using hidden Markov models

    • MEME Suite: For identification of conserved motifs

    • ConSurf: For mapping evolutionary conservation onto protein structures

Structural Analysis Tools:

  • Structure Prediction

    • AlphaFold2: For accurate protein structure prediction

    • I-TASSER: For integrated protein structure and function prediction

    • TMHMM/TOPCONS: For membrane topology prediction

    • SignalP: For signal peptide prediction

  • Structure Visualization and Analysis

    • PyMOL/Chimera: For visualization and analysis of protein structures

    • MDWeb: For molecular dynamics simulation setup

    • PDBeFold: For structural similarity searches

Specialized Databases:

  • Protein Databases

    • UniProt: For comprehensive protein information (ETA_15950 UniProt ID: B2VKV9)

    • Pfam: For protein domain identification

    • MEROPS: For peptidase classification and information

  • Bacterial Resources

    • BacDive: Contains information on Erwinia tasmaniensis Et1/99

    • KEGG: For metabolic pathway analysis

    • STRING: For protein-protein interaction networks

    • MicrobesOnline: For comparative genomics and gene context analysis

  • Cell Division Resources

    • TOPDB: Membrane protein topology database

    • CellShape Database: For bacterial morphology mutants

    • DIPRODB: Database of protein-protein interfaces

Analysis Pipelines:

  • Phylogenetic Analysis

    • MEGA X: For comprehensive phylogenetic analysis

    • PhyML/RAxML: For maximum likelihood tree construction

    • MrBayes: For Bayesian phylogenetic inference

  • Genomic Context Analysis

    • MicrobesOnline: For visualization of genomic neighborhoods

    • SyntTax: For synteny analysis across bacterial genomes

    • GeConT: For genomic context analysis

These resources provide a comprehensive toolkit for researchers investigating the sequence, structure, function, and evolution of ETA_15950 and related septation proteins across bacterial species.

How can researchers integrate genomic, proteomic, and phenotypic data to develop a comprehensive understanding of ETA_15950 function?

Developing a comprehensive understanding of ETA_15950 requires integration of multiple omics approaches:

Multi-Omics Integration Framework:

  • Genomic Analysis

    • Comparative genomics across Erwinia species

    • Analysis of selection pressure (dN/dS ratios)

    • Identification of regulatory elements

    • Synteny analysis of the genomic neighborhood

  • Transcriptomic Analysis

    • RNA-seq under various conditions

    • Co-expression network analysis

    • Identification of operon structure

    • Regulon mapping using ChIP-seq for relevant transcription factors

  • Proteomic Analysis

    • Global proteomics comparing wild-type and ETA_15950 mutants

    • Phosphoproteomics to identify regulatory modifications

    • Protein-protein interaction mapping

    • Membrane proteomics to identify co-localized proteins

  • Phenomic Analysis

    • High-throughput phenotyping under various conditions

    • Cell morphology analysis using high-content imaging

    • Growth and fitness measurements

    • Plant colonization efficiency

Data Integration Methods:

  • Network-Based Integration

    • Construction of multi-layered networks incorporating:

      • Gene co-expression

      • Protein-protein interactions

      • Metabolic relationships

      • Phenotypic correlations

    • Network analysis to identify modules and key nodes

  • Statistical Integration

    • Multi-omics factor analysis (MOFA)

    • Canonical correlation analysis

    • Partial least squares approaches

    • Bayesian networks for causal inference

  • Knowledge-Based Integration

    • Pathway enrichment across multiple data types

    • Gene ontology analysis to identify enriched functions

    • Literature-based discovery to connect disparate findings

    • Comparative analysis with known cell division pathways

Visualization and Interpretation:

  • Interactive visualization tools for multi-omics data

  • Hypothesis generation based on integrated networks

  • Experimental validation of key predictions

  • Iterative refinement of models based on new data

This integrative approach provides a systems-level understanding of ETA_15950 function that no single technique could achieve alone, revealing both direct mechanisms and broader cellular impacts of this septation protein.

What are the key research design considerations when planning to conduct comparative studies of ETA_15950 homologs across different bacterial species?

When designing comparative studies of ETA_15950 homologs across bacterial species, several key research design considerations must be addressed:

1. Homolog Selection Strategy:

  • Include representatives from diverse bacterial phyla

  • Select both close relatives (other Erwinia species) and distant homologs

  • Include both pathogenic and non-pathogenic species

  • Consider including both plant-associated and non-plant-associated bacteria

  • Balance breadth (taxonomic diversity) with depth (multiple strains within key species)

2. Sequence Analysis Framework:

  • Define clear criteria for homolog identification (e-value cutoffs, coverage requirements)

  • Use both sequence-based (BLAST) and profile-based (HMM) search methods

  • Perform rigorous phylogenetic analysis with appropriate models

  • Consider protein domain architecture in addition to sequence similarity

  • Account for horizontal gene transfer in evolutionary analyses

3. Functional Comparison Methodology:

  • Standardize experimental conditions across species

  • Develop species-neutral phenotypic assays when possible

  • Use complementation experiments in a common chassis organism

  • Design chimeric proteins to map functional domains

  • Consider species-specific factors that might influence protein function

4. Experimental Controls:

  • Include positive and negative controls for each species tested

  • Use wild-type and deletion mutants for each species where possible

  • Account for growth rate differences between species

  • Include technical and biological replicates with appropriate statistical analysis

  • Validate antibodies and reagents for cross-reactivity across species

5. Data Analysis and Integration:

  • Develop normalized metrics for cross-species comparison

  • Use appropriate statistical methods for comparative analyses

  • Account for phylogenetic relationships when interpreting differences

  • Integrate structural predictions with functional observations

  • Correlate sequence divergence with functional divergence

6. Technical Considerations:

  • Optimize protocols for each species (transformation, growth conditions)

  • Adjust genetic manipulation strategies based on available tools for each species

  • Standardize protein expression and purification methods

  • Account for codon usage differences when expressing genes heterologously

  • Consider species-specific regulatory elements when designing constructs

Addressing these considerations ensures robust comparative studies that can reveal evolutionary patterns in septation protein function across bacterial diversity.

What are the most promising future research directions for understanding the role of ETA_15950 in bacterial physiology and ecology?

Several promising research directions can advance our understanding of ETA_15950:

Structural Biology Approaches

  • Cryo-EM structures of ETA_15950 in membrane environments

  • In situ structural studies using cellular cryo-electron tomography

  • NMR studies of specific domains and interactions

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

Systems Biology Integration

  • Multi-omics profiling comparing wild-type and ETA_15950 mutants

  • Network modeling of cell division processes including ETA_15950

  • Global genetic interaction mapping using CRISPRi or transposon sequencing

  • Metabolic modeling to understand impacts on cellular energetics

Ecological and Host Interaction Studies

  • Metagenomic analysis of ETA_15950 homologs in plant microbiomes

  • Competition experiments between wild-type and mutant strains on plant surfaces

  • Tracking expression in situ during plant colonization

  • Multi-species biofilm studies to understand community context

Evolutionary Perspectives

  • Ancestral sequence reconstruction of septation proteins

  • Experimental evolution under different selective pressures

  • Horizontal gene transfer analysis of cell division genes

  • Comparative analysis across diverse plant-associated bacteria

Novel Technological Applications

  • Development of biosensors based on ETA_15950 properties

  • Exploration of biotechnological applications in biocontrol

  • Protein engineering to modify cell division properties

  • Synthetic biology approaches to create minimal division systems

Potential Impact:

  • Enhanced understanding of bacterial cell division mechanisms

  • Insights into adaptation to plant-associated lifestyles

  • New targets for antibacterial development

  • Improved models of bacterial evolution and speciation

These research directions would contribute significantly to our understanding of bacterial cell biology while potentially yielding practical applications in agriculture and biotechnology.

How might research on ETA_15950 contribute to broader understanding of bacterial adaptation to different ecological niches?

Research on ETA_15950 can provide valuable insights into bacterial adaptation to different ecological niches:

Comparative Ecology Framework

  • Compare ETA_15950 sequence, structure, and function across:

    • Plant-associated bacteria (epiphytes, endophytes, pathogens)

    • Soil bacteria

    • Aquatic bacteria

    • Host-associated bacteria (animal commensals and pathogens)

  • Correlate variations with ecological niche requirements

Adaptive Significance Analysis

  • Investigate selection pressures on ETA_15950 across different niches

  • Identify adaptive mutations in specific environments

  • Test fitness contributions in different ecological contexts

  • Map niche-specific protein-protein interactions

Cell Physiology in Context

  • Examine cell size and morphology regulation across niches

  • Compare division rates and resource allocation strategies

  • Study stress response integration with cell division

  • Analyze biofilm formation and community structure effects

Evolutionary Implications

  • Trace the evolution of septation mechanisms across ecological transitions

  • Identify convergent adaptations in similar niches

  • Study horizontal gene transfer patterns related to niche adaptation

  • Develop models of how cell division machinery co-evolves with ecological specialization

Key Hypotheses to Test:

  • ETA_15950 variants in plant-associated bacteria may show adaptations for surface attachment and biofilm formation

  • Expression regulation may differ between free-living and host-associated bacteria

  • Protein interaction networks involving ETA_15950 may vary based on environmental challenges

  • Post-translational modifications may fine-tune function for specific niche requirements

Understanding how a fundamental process like cell division adapts to different ecological contexts provides insights into bacterial evolution and specialization across diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.