Recombinant Erwinia tasmaniensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

General Role of Lgt in Bacterial Physiology

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, enabling membrane anchoring and subsequent modifications by signal peptidase II (LspA) and N-acyltransferase (Lnt) . This triacylated lipoprotein is essential for bacterial membrane integrity, virulence, and antibiotic resistance.

EnzymeFunctionKey Residues
LgtDiacylglyceryl transferY26, N146, G154 (critical); R143, E151, R239, E243 (supporting)
LspASignal peptide cleavageAspartic acid protease activity
LntN-acylationCysteine-dependent thioester acyltransferase

Key Insights from Related Erwinia Species

  • Genetic Homology: E. tasmaniensis shows genomic similarities to E. amylovora and E. billingiae, including plasmid-encoded genes that may influence membrane biology .

  • Lipoprotein Biosynthesis: Pathogenic Erwinia species rely on lipoproteins for host colonization, but E. tasmaniensis lacks virulence factors like exopolysaccharide (EPS) production .

Technical Hurdles

  1. Membrane Localization: Lgt is an inner membrane protein with seven transmembrane segments . Recombinant expression requires optimized solubilization and purification protocols.

  2. Conserved Motifs: The Lgt signature motif (L[A/S]G[C]) faces the periplasm and is critical for substrate recognition . Mutagenesis studies in E. coli Lgt identified residues Y26, N146, and G154 as essential .

  3. Inhibitor Development: Recent macrocyclic inhibitors (e.g., G2823, G2824) target E. coli Lgt, causing outer membrane permeabilization and bacterial death . Cross-species efficacy remains untested.

Hypothetical Workflow for Recombinant E. tasmaniensis Lgt

  1. Gene Cloning: Amplify lgt from E. tasmaniensis genomic DNA using primers designed for conserved regions (e.g., Lgt signature motif).

  2. Heterologous Expression: Use E. coli or Haloferax volcanii systems for soluble expression, as archaeal systems may better handle membrane proteins .

  3. Activity Assays: Measure glycerolphosphate release from phosphatidylglycerol using coupled luciferase assays .

Broader Implications for Erwinia Research

While E. tasmaniensis Lgt remains understudied, its characterization could:

  • Clarify Evolutionary Relationships: Compare Lgt homology across Erwinia species to infer genetic exchanges.

  • Target Epiphytic Bacteria: Develop Lgt inhibitors as biocontrol agents to disrupt non-pathogenic Erwinia communities.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; ETA_27600; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
lgt
Target Protein Sequence
MNNGYLAFPQFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWKKEEVENL LYAGFLGVFLGGRIGYVLFYNMPLFLENPLYLFKVWDGGMSFHGGLIGVIVVMLVFAHRT KRHFFQVADFIAPLIPFGLGAGRLGNFINGELWGRVDPNLPWAMLFPGSRSEDIALVAAH PQWQQLLSTYGVLPRHPSQLYELILEGVVLFIILNLFIRKSRPMGAVSGLFLIGYGAFRI IVEFFRQPDQQLGLFGGISMGQILSLPMILAGVIMMIWAYRRRPQQRIREAK
Uniprot No.

Target Background

Function
Recombinant Erwinia tasmaniensis Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Erwinia tasmaniensis Prolipoprotein diacylglyceryl transferase (lgt) and what is its function?

Erwinia tasmaniensis Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme that catalyzes the first irreversible step in bacterial lipoprotein biogenesis. This enzyme transfers diacylglyceryl from phosphatidylglycerol to a conserved cysteine residue in prolipoproteins, creating a thioether bond and releasing glycerol phosphate as a by-product . Lgt is crucial for bacterial growth and pathogenesis, as it initiates the modification of lipoproteins that play essential roles in bacterial cell envelope integrity and function .

E. tasmaniensis itself is a non-pathogenic epiphytic bacterium isolated from flowers and bark of apple and pear trees in Australia . It represents an interesting subject for research as it is closely related to pathogenic Erwinia species but lacks virulence factors found in its pathogenic relatives .

How does E. tasmaniensis compare to other bacterial species in the Erwinia genus?

E. tasmaniensis occupies a unique phylogenetic position within the Erwinia genus. Genome analysis reveals:

  • E. tasmaniensis strain Et1/99 is an epiphytic plant bacterium closely related to the pathogenic species Erwinia amylovora (fire blight pathogen) and E. pyrifoliae (Asian pear shoot blight pathogen) .

  • It marks the boundary between Rosaceae-infecting and non-infecting bacterial strains in comparative genomic analyses .

  • Unlike its pathogenic relatives, E. tasmaniensis lacks several critical virulence genes including dspF, hrpA, hrpK, amsE, amsK, and edcC .

  • It shares similarities with E. piriflorinigrans (a pear tree pathogen) but has different gene presence/absence patterns .

  • E. tasmaniensis completely lacks the sorbitol operon, which may contribute to its inability to invade fire blight host plants, in contrast to E. amylovora which depends on sorbitol utilization for virulence .

This non-pathogenic nature makes E. tasmaniensis valuable for comparative studies with pathogenic relatives to understand the genetic basis of virulence.

What are the essential residues in bacterial lgt enzymes and their functions?

Studies on E. coli lgt, which shares significant homology with E. tasmaniensis lgt, have identified several critical residues essential for function :

ResidueLocationEffect of MutationProposed Function
Y26TM-1Loss of functionLikely involved in catalysis
H103TM-3Growth to mid-exponential phase followed by cell lysisCatalytic mechanism
R143TM-4Loss of functionSubstrate binding/recognition
N146TM-4Loss of functionSubstrate recognition
G154Loop between TM-4 and head domainLoss of functionStructural integrity
R239TM-6Loss of functionSubstrate binding/catalysis
G98Between arm-2 and TM-3Delayed growthStructural flexibility
G104TM-3Delayed growthStructural integrity
E151Loop between TM-4 and head domainDelayed growthSubstrate interaction
D129-Minimal effectNon-essential
E243-Minimal effectNon-essential

These residues are likely conserved in E. tasmaniensis lgt and would be prime targets for site-directed mutagenesis studies to confirm their functional significance .

What is the significance of studying non-pathogenic Erwinia species like E. tasmaniensis?

Studying non-pathogenic Erwinia species like E. tasmaniensis offers several significant advantages:

  • Safety and Practicality: As a non-pathogen, E. tasmaniensis can be handled without the biosafety concerns associated with pathogenic species .

  • Evolutionary Insights: It provides a model for understanding the evolutionary relationships between pathogenic and non-pathogenic bacteria within the same genus .

  • Virulence Factor Identification: Comparative genomics between E. tasmaniensis and pathogenic Erwinia species helps identify genes specifically required for pathogenicity .

  • Biocontrol Applications: Understanding non-pathogenic Erwinia may lead to biocontrol strategies against pathogenic relatives like E. amylovora, which causes economically significant fire blight disease in apple and pear crops .

  • Fundamental Bacterial Biology: Studying conserved processes like lipoprotein biogenesis in non-pathogenic models contributes to our understanding of bacterial physiology more broadly .

What methods are optimal for expression and purification of recombinant E. tasmaniensis lgt?

Based on available protocols and literature for membrane proteins like lgt, the following optimized methodology is recommended:

Expression System:

  • Vector: pET series with T7 promoter

  • Host: E. coli BL21(DE3) or C41/C43(DE3) for membrane proteins

  • Fusion Tag: N-terminal 10xHis tag has been successfully used

Expression Protocol:

  • Transform expression plasmid into host cells

  • Grow cultures at 37°C to mid-log phase (OD600 ~0.6)

  • Reduce temperature to 18-20°C before induction

  • Induce with low IPTG concentration (0.1-0.5 mM)

  • Continue expression overnight (16-18 hours)

Purification Strategy:

  • Harvest cells and resuspend in buffer containing protease inhibitors

  • Disrupt cells (sonication or French press)

  • Isolate membranes by ultracentrifugation

  • Solubilize membranes with gentle detergents (DDM, LDAO)

  • Perform IMAC purification using Ni-NTA or similar resin

  • Further purify by size exclusion chromatography if needed

Storage Conditions:

  • Store in Tris-based buffer with 50% glycerol or 6% trehalose at pH 8.0

  • Store at -20°C/-80°C

  • Aliquot to avoid repeated freeze-thaw cycles

This methodology has been validated for other bacterial membrane proteins and should yield functionally active recombinant E. tasmaniensis lgt.

How can the enzymatic activity of E. tasmaniensis lgt be measured in vitro?

The enzymatic activity of E. tasmaniensis lgt can be measured using several complementary approaches:

1. Glycerol Phosphate Release Assay:
This assay measures the release of glycerol phosphate, a by-product of the lgt catalytic reaction .

Materials:

  • Purified recombinant E. tasmaniensis lgt

  • Phosphatidylglycerol substrate (contains racemic glycerol moiety)

  • Synthetic peptide substrate (e.g., Pal-IAAC, where C is the conserved cysteine)

  • G3P detection system (coupled luciferase reaction)

Procedure:

  • Incubate lgt with phosphatidylglycerol and peptide substrate

  • As lgt catalyzes the reaction, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released

  • Detect G3P using a coupled enzyme reaction with luciferase

  • Generate a standard curve to quantify G3P release

  • Calculate enzyme activity based on G3P production rate

Controls:

  • Negative control: Reaction without enzyme

  • Substrate specificity control: Mutant peptide substrate (e.g., Pal-IAAA where cysteine is replaced with alanine)

2. Direct Product Detection by Mass Spectrometry:

Procedure:

  • Incubate lgt with substrates

  • Quench reaction at various timepoints

  • Analyze by LC-MS/MS to detect modified peptide products

  • Determine reaction kinetics (Km, Vmax)

This multi-faceted approach provides comprehensive characterization of E. tasmaniensis lgt enzymatic activity and allows comparison with lgt from other bacterial species.

What strategies can be employed to identify potential inhibitors of E. tasmaniensis lgt?

Based on successful approaches with E. coli lgt, the following strategies can be employed to identify potential inhibitors of E. tasmaniensis lgt:

1. High-Throughput Biochemical Screening:

  • Adapt the glycerol phosphate release assay to 384-well format

  • Screen compound libraries (10,000-100,000 compounds)

  • Identify hits that inhibit >50% of enzyme activity at 10 μM

  • Perform dose-response studies to determine IC50 values

  • Filter compounds based on chemical tractability and novelty

2. Structure-Based Virtual Screening:

  • Generate homology models of E. tasmaniensis lgt based on related structures

  • Identify potential binding pockets, particularly around conserved catalytic residues

  • Perform virtual screening of compound libraries using molecular docking

  • Select top-scoring compounds for biochemical validation

3. Fragment-Based Screening:

  • Use thermal shift assays or NMR to identify fragments that bind to lgt

  • Expand fragments into lead compounds through iterative optimization

  • Test optimized compounds in biochemical assays

4. Validation and Characterization:

  • Determine mechanism of action (competitive vs. non-competitive)

  • Assess specificity by testing against lgt from other bacterial species

  • Evaluate effects on bacterial growth and membrane integrity

  • Determine structure-activity relationships through analog testing

5. Resistance Studies:

  • Attempt to generate resistance mutations in laboratory strains

  • Analyze any resistant mutants to understand the inhibitor binding site

These approaches have successfully identified the first Lgt inhibitors for E. coli that are bactericidal against wild-type strains .

How does mutation of conserved residues affect lgt function and what methodologies can be used to study this?

Studies with E. coli lgt have shown that mutation of conserved residues has varying effects on function, which can be categorized as follows:

Effect CategoryResiduesObserved Phenotype
EssentialY26, N146, G154, R143, R239Complete loss of function, no growth
CriticalH103Growth to mid-exponential phase followed by cell lysis
ImportantG98, G104, E151Delayed growth
Non-essentialD129, E243Normal growth

To systematically study the effects of mutations in E. tasmaniensis lgt, the following methodologies can be employed:

1. Site-Directed Mutagenesis and Complementation:

  • Generate alanine substitutions of conserved residues in E. tasmaniensis lgt

  • Express these variants in an E. coli lgt depletion strain (e.g., ΔlgtΔlpp)

  • Monitor growth, morphology, and viability

  • This approach has successfully identified essential residues in E. coli lgt

2. In Vitro Enzymatic Activity:

  • Purify the mutant proteins and assess their enzymatic activity

  • Determine if mutations affect substrate binding (altered Km) or catalytic efficiency (altered kcat)

  • Compare with wild-type enzyme

3. Structural Studies:

4. Molecular Dynamics Simulations:

  • Model the effects of mutations on protein dynamics and substrate interactions

  • Identify potential long-range effects on protein conformation

These complementary approaches would provide comprehensive insights into the roles of conserved residues in E. tasmaniensis lgt function.

How can comparative genomics be used to understand the evolution and function of lgt across bacterial species?

Comparative genomics offers powerful approaches to understand lgt evolution and function:

1. Phylogenetic Analysis of Lgt Sequences:

  • Collect lgt sequences from diverse bacterial species

  • Perform multiple sequence alignment

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Identify clades that correlate with bacterial taxonomy or lifestyle

2. Conservation Analysis:

  • Map sequence conservation onto predicted structures

  • Identify universally conserved residues (likely essential for catalysis)

  • Detect lineage-specific conservation patterns that might reflect adaptation

3. Genomic Context Analysis:

  • Examine gene neighborhoods around lgt in different bacteria

  • Identify co-occurring genes that might be functionally related

  • Detect operon structures or regulatory elements

4. Correlation with Bacterial Lifestyle:

  • Compare lgt from pathogenic vs. non-pathogenic bacteria (e.g., E. amylovora vs. E. tasmaniensis)

  • Identify variations that might correlate with host range or virulence

  • Analyze substrate repertoires in different species

5. Methodological Implementation:

  • Use software like BLAST, Clustal Omega, MEGA, and ConSurf

  • Integrate with experimental validation of predictions

  • Generate testable hypotheses about lgt function in different bacteria

This approach has been successfully used to understand the evolution of virulence factors in the Erwinia genus and could be applied specifically to lgt.

What experimental approaches can be used to determine the substrate specificity of E. tasmaniensis lgt?

Understanding substrate specificity of E. tasmaniensis lgt requires a multi-faceted experimental approach:

1. Synthetic Peptide Library Screening:

  • Design a library of peptide substrates with variations in the lipobox motif

  • Standard lipobox: L-A/S-G/A-C (where C is the modified cysteine)

  • Create variants with systematic amino acid substitutions

  • Measure lgt activity on each substrate using the glycerol phosphate release assay

  • Determine specificity profiles and compare with lgt from other bacteria

2. Proteomics-Based Substrate Identification:

  • Express E. tasmaniensis lgt in an E. coli lgt depletion strain

  • Use metabolic labeling to tag newly synthesized proteins

  • Compare lipoprotein profiles via 2D gel electrophoresis or LC-MS/MS

  • Identify which E. coli lipoproteins are efficiently modified by E. tasmaniensis lgt

3. Competitive Substrate Assays:

  • Use pairs of potential substrates in competition assays

  • Determine relative preference through kinetic analysis

  • Calculate specificity constants (kcat/Km) for different substrates

4. Structural Studies with Substrate Analogs:

  • Co-crystallize lgt with non-hydrolyzable substrate analogs

  • Identify binding interactions that determine specificity

  • Map specificity-determining residues

5. Molecular Dynamics Simulations:

  • Model interactions between lgt and various substrate peptides

  • Identify key interactions that contribute to recognition

  • Generate predictions that can be tested experimentally

These approaches would provide comprehensive insights into E. tasmaniensis lgt substrate preferences and the molecular basis of specificity.

How can RNA-seq be utilized to study the physiological role of lgt in bacterial systems?

RNA-seq provides a powerful approach to understand the physiological impact of lgt disruption or inhibition:

1. Experimental Design for Transcriptome Analysis:

  • Create an inducible depletion system for lgt (as direct knockouts are lethal)

  • Compare transcriptomes before and after lgt depletion

  • Alternatively, treat with sub-lethal concentrations of lgt inhibitors

  • Include appropriate controls (e.g., depletion of other essential genes)

2. RNA-seq Methodology:

  • Extract total RNA from bacterial cultures

  • Deplete rRNA to enrich for mRNA

  • Prepare sequencing libraries (stranded protocols recommended)

  • Sequence on high-throughput platforms (30-50 million reads per sample)

  • Map reads to reference genome and quantify expression

3. Data Analysis Workflow:

  • Normalize counts to account for sequencing depth

  • Identify differentially expressed genes (DEGs)

  • Perform clustering and pathway enrichment analysis

  • Validate key findings with qRT-PCR

4. Expected Insights:

  • Stress response pathways activated by lgt depletion

  • Compensatory mechanisms for membrane integrity

  • Effects on cell envelope biogenesis pathways

  • Potential biomarkers of lgt inhibition

5. Integration with Other Data Types:

  • Correlate transcriptomic changes with phenotypic observations

  • Compare with proteomic analysis of membrane proteins

  • Integrate with metabolomic data to understand broader physiological impact

This approach has been successfully used to study the Type VI secretion regulome in Erwinia amylovora and could be adapted to study lgt.

What structural characterization methods are most suitable for E. tasmaniensis lgt?

As a membrane protein, E. tasmaniensis lgt presents challenges for structural characterization. The following complementary methods are recommended:

1. X-ray Crystallography:

  • Express lgt with fusion partners to aid crystallization (e.g., T4 lysozyme)

  • Use lipidic cubic phase (LCP) crystallization

  • Screen detergents systematically to identify conditions that maintain function

  • Co-crystallize with substrate analogs or inhibitors to capture functional states

  • Challenge: Obtaining diffraction-quality crystals

2. Cryo-Electron Microscopy (cryo-EM):

  • Reconstitute lgt in nanodiscs or amphipols

  • Optimize sample preparation for uniform particle distribution

  • Use state-of-the-art cryo-EM facilities for high-resolution data collection

  • Advantage: Can capture multiple conformational states

  • Challenge: Size limitations for smaller membrane proteins

3. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Monitor solvent accessibility of different protein regions

  • Identify dynamic regions and potential substrate binding sites

  • Advantage: Works well for membrane proteins

  • Challenge: Limited spatial resolution

4. Computational Modeling with Experimental Constraints:

  • Generate homology models based on related structures

  • Validate with experimental constraints from mutagenesis

  • Refine using molecular dynamics simulations

  • Predict substrate and inhibitor binding modes

5. Integrated Structural Biology Approach:

  • Combine low-resolution experimental data with computational modeling

  • Use cross-linking mass spectrometry to identify spatial constraints

  • Validate predictions with functional assays

This multi-technique approach would provide the most comprehensive structural insights into E. tasmaniensis lgt.

How can complementation studies be designed to assess functional conservation between lgt from different bacterial species?

Complementation studies are powerful tools to assess functional conservation of lgt across species:

1. Generation of Conditional Lgt Depletion Strains:

  • Create an E. coli strain with the endogenous lgt under control of an inducible promoter

  • Alternatively, use an lgt depletion strain (ΔlgtΔlpp) to reduce toxicity issues

  • These strains should show growth dependence on inducer presence

2. Expression System for Heterologous Lgt:

  • Clone lgt genes from various bacterial species (including E. tasmaniensis)

  • Use compatible plasmids with different antibiotic markers

  • Place under control of a constitutive or inducible promoter

  • Include appropriate tags for detection (e.g., FLAG, His)

3. Complementation Assay Design:

  • Transform depletion strain with plasmids expressing heterologous lgt

  • Remove inducer to deplete endogenous lgt

  • Monitor growth on solid media and in liquid culture

  • Assess cell morphology by microscopy

  • Measure membrane integrity using dye exclusion assays

4. Quantitative Assessment:

  • Compare growth rates and final cell densities

  • Determine minimum expression levels needed for complementation

  • Assess complementation under various stress conditions

  • Analyze lipoprotein modification profiles by mass spectrometry

5. Mutational Analysis:

  • Introduce equivalent mutations in conserved residues across species

  • Compare effects on complementation ability

  • Identify species-specific differences in residue importance

This systematic approach would provide insights into functional conservation and divergence of lgt across bacterial species, which has both evolutionary and potential therapeutic implications.

What bioinformatic tools and databases are most useful for analyzing E. tasmaniensis lgt in the context of bacterial evolution?

A comprehensive bioinformatic analysis of E. tasmaniensis lgt requires a combination of specialized tools and databases:

1. Sequence Analysis Tools:

  • BLAST/PSI-BLAST: For identifying homologs across bacterial species

  • Clustal Omega/MUSCLE: For multiple sequence alignment of lgt sequences

  • MEGA/RAxML: For phylogenetic tree construction

  • ConSurf: For mapping sequence conservation onto structures

2. Structural Analysis Tools:

  • AlphaFold2/I-TASSER: For protein structure prediction

  • TMHMM/TOPCONS: For transmembrane topology prediction

  • PyMOL/UCSF Chimera: For structural visualization and analysis

  • FTMap: For identifying potential binding pockets

3. Genomic Context Analysis:

  • MicrobesOnline/IMG: For examining gene neighborhoods

  • STRING: For protein interaction networks

  • DOOR: For operon prediction

4. Specialized Databases:

  • UniProt: For curated protein information

  • Pfam/InterPro: For domain analysis

  • TCDB: For transporter classification

  • PATRIC: For bacterial pathogen data

5. Lipoprotein Prediction Tools:

  • LipoP: For lipoprotein signal peptide prediction

  • PRED-LIPO: For lipoprotein prediction in Gram-positive bacteria

  • SignalP: For signal peptide prediction

Recommended Analysis Workflow:

  • Collect lgt sequences from diverse bacterial species

  • Perform multiple sequence alignment and identify conserved motifs

  • Construct a phylogenetic tree to visualize evolutionary relationships

  • Map conservation onto predicted structures

  • Compare with experimental data on essential residues

  • Analyze genomic context for functional associations

  • Predict and compare substrate repertoires across species

This integrated bioinformatic approach would provide a comprehensive evolutionary and functional context for E. tasmaniensis lgt.

How can E. tasmaniensis lgt be utilized in drug discovery targeting bacterial pathogens?

E. tasmaniensis lgt offers several advantages for antibiotic drug discovery:

1. Target Validation Platform:

  • E. tasmaniensis is non-pathogenic, allowing safer handling in early discovery

  • Lgt is essential in proteobacteria, making it a valid antibiotic target

  • Inhibition of Lgt leads to membrane permeabilization and increased sensitivity to antibiotics and serum killing

2. Inhibitor Screening Strategy:

  • Use purified E. tasmaniensis lgt for initial high-throughput screening

  • Validate hits against lgt from pathogenic bacteria (E. coli, A. baumannii)

  • Test for spectrum of activity across diverse bacterial species

  • Assess resistance development potential (shown to be low for lgt inhibitors)

3. Potential Advantages of Lgt Inhibitors:

  • Unlike inhibitors of other steps in lipoprotein biosynthesis, deletion of lpp is not sufficient to provide resistance to Lgt inhibitors

  • This suggests lgt inhibitors may avoid common resistance mechanisms

  • Lgt inhibitors cause multiple cellular effects, potentially reducing resistance development

4. Development Path:

  • Identify initial hits from biochemical screens

  • Optimize potency and properties through medicinal chemistry

  • Test against panels of clinical isolates

  • Evaluate toxicity and selectivity

  • Develop structure-activity relationships

This approach leverages the non-pathogenic nature of E. tasmaniensis while targeting a conserved essential enzyme present in pathogenic bacteria.

What role might comparative studies of E. tasmaniensis play in understanding bacterial plant pathogenesis?

E. tasmaniensis occupies a unique niche for comparative studies of plant pathogenesis:

1. Evolutionary Context for Pathogenicity:

  • E. tasmaniensis is closely related to pathogenic Erwinia species but is non-pathogenic

  • It marks the boundary between Rosaceae-infecting and non-infecting bacteria in phylogenetic analyses

  • Comparative genomics reveals the presence/absence of key virulence-associated genes

2. Key Insights from Comparative Studies:

  • E. tasmaniensis lacks several critical virulence genes (dspF, hrpA, hrpK, amsE, amsK, edcC)

  • It completely lacks the sorbitol operon, which E. amylovora requires for virulence on rosaceous plants

  • Several disease-specific (dsp) Hrp-associated pathogenicity-avirulence proteins necessary for fire blight disease are absent or divergent

3. Experimental Approaches:

  • Compare protein function across pathogenic and non-pathogenic Erwinia species

  • Express E. tasmaniensis proteins in pathogenic species to assess functional complementation

  • Analyze substrate specificities to identify adaptations to different plant hosts

  • Develop plant infection models to evaluate virulence determinants

4. Potential Applications:

  • Development of biocontrol strategies against fire blight

  • Identification of minimal virulence determinants for plant pathogenesis

  • Engineering of non-pathogenic strains with desired plant-beneficial properties

These comparative studies provide fundamental insights into the molecular basis of pathogenesis in the Erwinia genus.

How can researchers design effective mutation studies to evaluate essential residues in E. tasmaniensis lgt?

Based on previous studies with E. coli lgt , an effective mutation study design would include:

1. Selection of Target Residues:

  • Highly conserved residues identified through sequence alignment

  • Focus on the Lgt signature motif and other invariant residues

  • Include residues in transmembrane domains and loop regions

  • Target residues in predicted substrate binding sites

2. Mutation Strategy:

  • Generate alanine substitutions as a primary screen

  • For positive hits, create more conservative substitutions

  • Include mutations shown to be critical in E. coli lgt (Y26, H103, R143, N146, G154, R239)

  • Generate double mutations to test functional interactions

3. Expression and Purification:

  • Optimize expression conditions for each mutant

  • Verify protein production by Western blot

  • Ensure comparable purification yields and purity

  • Assess protein folding by circular dichroism

4. Functional Assessment:

  • In vitro activity assays: Measure enzymatic activity using glycerol phosphate release assay

  • Complementation studies: Test ability to rescue growth in an lgt depletion strain

  • Substrate binding: Assess changes in substrate affinity (Km)

  • Catalytic efficiency: Determine effects on turnover rate (kcat)

5. Structural Interpretation:

  • Map mutations onto predicted structural models

  • Correlate functional effects with structural locations

  • Generate hypotheses about roles in catalysis or substrate binding

This systematic approach would provide comprehensive insights into the structure-function relationships of E. tasmaniensis lgt and guide future inhibitor development efforts.

What are the key considerations for developing a high-quality research question focused on E. tasmaniensis lgt?

Developing a high-quality research question about E. tasmaniensis lgt requires careful consideration of several factors:

1. Question Types and Their Characteristics:

Research Question TypeCharacteristicsExample for E. tasmaniensis lgt
DescriptiveIdentifies and describes existing conditionsWhat is the substrate specificity profile of E. tasmaniensis lgt?
ComparativeExamines similarities/differencesHow does substrate specificity of E. tasmaniensis lgt differ from pathogenic Erwinia species?
CorrelationalExplores relationships between variablesWhat is the relationship between E. tasmaniensis lgt structure and its substrate preference?
ExplanatoryExamines causes or reasonsWhat molecular mechanisms explain the substrate selectivity of E. tasmaniensis lgt?
ExploratoryInvestigates unknown aspectsCan E. tasmaniensis lgt recognize and modify novel synthetic peptide substrates?

2. Characteristics of High-Quality Research Questions:

  • Clear and focused: Specific enough to guide methodology

  • Feasible: Answerable with available technology and resources

  • Novel: Extends beyond existing knowledge

  • Relevant: Contributes meaningfully to the field

  • In-depth: Sufficiently complex to warrant extensive research

3. Literature-Based Development Process:

  • Conduct thorough literature review on lgt enzymes

  • Identify knowledge gaps in current understanding

  • Focus on aspects unique to E. tasmaniensis

  • Consider the non-pathogenic nature as a potential advantage

4. Question Refinement Example:

Initial QuestionRefined QuestionJustification
How does E. tasmaniensis lgt work?How do specific residues in the head domain of E. tasmaniensis lgt contribute to substrate recognition compared to pathogenic Erwinia species?More specific, comparative, testable, and addresses a knowledge gap

5. Evaluation Criteria:

  • Does the question generate testable hypotheses?

  • Is it answerable within a reasonable timeframe?

  • Does it build on existing knowledge while extending it?

  • Will the answer contribute meaningfully to bacterial physiology or drug discovery?

Following these guidelines will help researchers develop focused, impactful research questions about E. tasmaniensis lgt.

What experimental controls are essential when working with recombinant E. tasmaniensis lgt?

Rigorous experimental controls are crucial for reliable research with recombinant E. tasmaniensis lgt:

1. Expression and Purification Controls:

  • Empty vector control: Cells transformed with expression vector lacking the lgt gene

  • Inactive mutant control: Expression of catalytically inactive lgt (e.g., Y26A mutation)

  • Tag-only control: Expression of the tag portion without lgt

  • Batch consistency control: Reference standard from a well-characterized batch

2. Enzymatic Activity Assay Controls:

  • No-enzyme control: Complete reaction mixture without lgt

  • Heat-inactivated enzyme: Lgt denatured by heating

  • Substrate specificity control: Non-substrate peptide (e.g., Pal-IAAA without the critical cysteine)

  • Known inhibitor control: If available, a validated lgt inhibitor

  • Positive control: E. coli lgt with established activity

3. Complementation Study Controls:

  • Empty vector control: Depletion strain with vector lacking lgt gene

  • Wild-type complementation: Depletion strain with plasmid expressing wild-type E. coli lgt

  • Non-complementing control: Depletion strain with plasmid expressing known inactive lgt

  • Expression level control: Western blot to verify comparable protein expression levels

4. Mutation Study Controls:

  • Wild-type protein control: Non-mutated E. tasmaniensis lgt

  • Expression control: Verification of comparable expression levels

  • Folding control: CD spectroscopy to confirm proper folding

  • Stability control: Thermal shift assay to assess protein stability

5. Structural Studies Controls:

  • Detergent-only crystals: Crystallization conditions without protein

  • Known structure control: Well-characterized membrane protein prepared in parallel

  • Sample homogeneity control: Size exclusion chromatography profile

What are the most significant research opportunities involving E. tasmaniensis lgt?

The most promising research directions for E. tasmaniensis lgt include:

  • Comparative Enzymatic Studies: Systematic comparison of substrate specificity and catalytic efficiency between lgt from pathogenic and non-pathogenic Erwinia species could reveal adaptations related to bacterial lifestyle and host range .

  • Structural Biology: Determining the three-dimensional structure of E. tasmaniensis lgt would provide critical insights into the catalytic mechanism and guide rational inhibitor design .

  • Antibiotic Development: Using E. tasmaniensis lgt as a safer, non-pathogenic platform for high-throughput screening of inhibitors that could be developed into novel antibiotics targeting Gram-negative pathogens .

  • Protein Engineering: Developing modified versions of E. tasmaniensis lgt with altered substrate specificity for biotechnological applications in lipid biochemistry and membrane protein studies.

  • Evolutionary Studies: Leveraging E. tasmaniensis lgt to understand the evolution of essential bacterial processes and how they relate to pathogenicity within the Erwinia genus and beyond .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.