Recombinant Erwinia tasmaniensis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Erwinia tasmaniensis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose Transferase (ArnC)

Recombinant Erwinia tasmaniensis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, commonly referred to as ArnC, is an enzyme that plays a crucial role in bacterial lipopolysaccharide (LPS) biosynthesis . Specifically, ArnC catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate . The resulting modified arabinose is then attached to lipid A, a process essential for polymyxin resistance in E. coli . ArnC is a type-2 glycosyltransferase (GT-2) localized to the inner membrane . Deletion of the arnC gene decreases the level of UndP-Ara4FN, which confirms its role in the formation of UndP-Ara4FN .

ArnC and UDP Binding

ArnC facilitates the transfer of UDP-L-Ara4N from the cytosol to produce UndP-Ara4FN in the inner membrane . Cryo-EM studies have revealed a ligand-bound state of ArnC when incubated with Mn2+ and UDP, with the structure refined to 3.8 Å . The UDP binding pocket involves 14 amino acid residues from the ArnC IH1/2 and A-loop, suggesting the location of the sugar-binding site in this protein . UDP binding induces conformational changes, with an RMSD of 2.46 Å and a TM-score of 0.88 between bound and unbound structures .

Functional Domains and Sequence Analysis of ArnA

Sequence analysis of ArnA reveals two discrete catalytic domains :

  • An N-terminal formyltransferase domain

  • A C-terminal sugar nucleotide-binding domain

ArnC Comparison to DPMS

Significant differences exist in the architecture of the transmembrane region between ArnC and DPMS (dolichyl-phosphate mannose synthase), despite a 28% primary sequence identity . ArnC features two extended TM helices, while DPMS has four TM helices that anchor it to the endoplasmic reticulum (ER) membrane . Additionally, ArnC functions as a tetramer, unlike DPMS, which is expected to function as a monomer or dimer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; ETA_23820; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Target Names
arnC
Target Protein Sequence
MTEQSIKKVSVVIPVYNEQQSLPELMRRTDAACAQLALDYEILLVDDGSSDDSAAMLVAA AEAPDSHIVAVLLNRNYGQHSAIMAGFSHVSGDLVITLDADLQNPPEEIPRLVETAQQGY DVVGTVRQNRQDSGFRKIASRAINHLIQRATGKAMGDYGCMLRAYRRHIVDAMLNCHERS TFIPILANTFARQATEIPVLHAEREFGDSKYSLMSLINLMYDLITCLTTTPLRLLSVIGS VIALMGFAFSLLLIALRLFLGAEWAGDGVFMLFAVLFIFIGAQFVGMGLLGEYIGRIYND VRARPRYFIQRVVSRDADSTKDKKS
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to bacterial resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of ArnC and how does it contribute to antimicrobial resistance?

ArnC catalyzes the attachment of a formylated form of aminoarabinose (L-Ara4N) to the lipid undecaprenyl phosphate. This enzymatic modification is part of the pathway that ultimately leads to the modification of Lipid A with aminoarabinose, which enables bacterial resistance against polymyxin antibiotics and cationic antimicrobial peptides in Gram-negative bacteria . This lipid modification appears to alter the surface charge of the bacterial outer membrane, reducing the binding affinity of cationic antimicrobial compounds.

Research methodologies to investigate this function include:

  • In vitro glycosyltransferase assays with purified recombinant enzyme

  • Lipid extraction and analysis by mass spectrometry

  • Comparative analysis of lipid compositions between wild-type and arnC mutant strains

How is ArnC structurally organized as an integral membrane protein?

As an integral membrane glycosyltransferase, ArnC contains transmembrane domains that anchor it within the cytoplasmic membrane . While the detailed structural information is still emerging, researchers should consider:

  • Transmembrane topology prediction using bioinformatic tools

  • Protein engineering approaches including reporter fusions to determine membrane orientation

  • Structural homology modeling based on related glycosyltransferases

What expression systems have proven successful for recombinant ArnC production?

While specific expression systems for ArnC are still being optimized, lessons from other membrane protein expression studies can be applied:

  • Consider specialized E. coli strains designed for membrane protein expression

  • Expression temperature modulation (typically lowered to 16-20°C) can improve folding

  • Codon optimization based on expression host

  • Fusion tags that enhance solubility without compromising function

Drawing from experiences with other recombinant membrane proteins, expression and purification protocols similar to those used for archaeal membrane proteins might be adaptable, where cloned genes are expressed in heterologous systems and then purified using affinity chromatography .

What are the critical considerations for purifying functional ArnC?

Purification of integral membrane proteins like ArnC presents specific challenges:

  • Selection of appropriate detergents for extraction (typically mild non-ionic detergents)

  • Detergent exchange during purification to maintain protein stability

  • Consideration of lipid supplementation to maintain enzyme activity

  • Buffer optimization to preserve native conformation and activity

Researchers might consider approaches where the protein is expressed with affinity tags to facilitate purification while maintaining the integrity of transmembrane domains and catalytic sites.

How might expression of arnC be regulated in Enterobacteriaceae?

While direct regulatory mechanisms for arnC aren't specified in the search results, insights can be drawn from related regulatory systems in Enterobacteriaceae:

The Rcs phosphorelay system, a modified two-component signal transduction system found exclusively in Enterobacteriaceae, has been shown to regulate resistance to polymyxin B in Erwinia amylovora . This system consists of RcsB, RcsC, and RcsD proteins that form a phosphorelay system responding to environmental signals . Similar regulatory mechanisms might control arnC expression, particularly since both systems contribute to polymyxin resistance.

Experimental approaches to investigate regulation include:

  • Promoter-reporter fusion assays

  • Chromatin immunoprecipitation to identify transcription factor binding

  • Transcriptome analysis under antibiotic stress conditions

What environmental signals trigger arnC expression?

Based on findings with the Rcs system in E. amylovora, which confers "some level of resistance to polymyxin B" , arnC expression might be triggered by:

  • Exposure to sub-inhibitory concentrations of antimicrobial peptides

  • Environmental pH changes

  • Membrane stress conditions

  • Nutrient limitation during host infection

Research methods to explore these signals include:

  • qRT-PCR analysis of arnC expression under various conditions

  • Reporter fusion constructs to monitor promoter activity

  • Systematic environmental parameter variation in controlled growth conditions

What techniques are effective for creating arnC knockout mutants?

Drawing from approaches used with other genes in Erwinia species:

The λ-Red recombination system has proven effective for generating non-polar insertional mutants in Erwinia species, as demonstrated with rcs genes in E. amylovora . This technique allows for precise gene disruption with minimal polar effects on downstream genes. For arnC studies, researchers should:

  • Design PCR primers with homology to flanking regions of arnC

  • Include antibiotic resistance cassettes for selection

  • Verify insertions by PCR and sequencing

  • Confirm non-polar effects through complementation studies

How can complementation studies verify arnC phenotypes?

Complementation approaches similar to those used for rcs mutants in E. amylovora can be employed:

  • Cloning the intact arnC gene with its native promoter

  • Using appropriate low-copy or high-copy vectors depending on expression requirements

  • Transformation into the arnC mutant background

  • Assessment of restored phenotypes, particularly polymyxin resistance

In E. amylovora studies, complemented strains of rcs mutants restored wild-type phenotypes, confirming the specificity of the mutations . Similar approaches would be valuable for arnC functional verification.

How conserved is ArnC across different members of Enterobacteriaceae?

While specific conservation data for ArnC is not provided in the search results, patterns of conservation for other proteins in Enterobacteriaceae may provide insights:

In the Rcs system of E. amylovora, RcsB is highly conserved (92% amino acid identity with E. coli and 99% with E. tasmaniensis), while RcsC and RcsD show lower conservation (61% and 52% identity with E. coli, respectively) . This suggests that proteins in these bacteria often show variable conservation reflecting their evolutionary relationships and functional constraints.

Research approaches to assess ArnC conservation include:

  • Comparative genomic analysis across Enterobacteriaceae

  • Phylogenetic tree construction based on ArnC sequences

  • Functional complementation studies across species

Do functional differences exist in ArnC between Erwinia tasmaniensis and other Gram-negative bacteria?

Based on observations from the Rcs system, where "rcs genes in E. amylovora are more homologous to those of E. tasmaniensis than to those of Es. coli" , ArnC likely exhibits species-specific functional adaptations.

To investigate these differences, researchers should consider:

  • Heterologous expression of ArnC from different species

  • Cross-species complementation studies

  • Biochemical characterization of enzyme kinetics and substrate specificity

  • Structural comparisons through homology modeling or direct structural determination

How does ArnC-mediated lipid modification compare to other polymyxin resistance mechanisms?

The ArnC-catalyzed attachment of formylated aminoarabinose to undecaprenyl phosphate is part of a specific resistance pathway against polymyxins . This mechanism should be compared with other known resistance strategies:

Resistance MechanismMolecular BasisBacterial SpeciesRelative Efficacy
L-Ara4N modificationLPS modification via ArnC pathwayEnterobacteriaceaeHigh resistance to polymyxins
PhoP/PhoQ activationLPS modification through multiple pathwaysSalmonella, E. coliModerate to high resistance
Rcs systemUnclear direct mechanism in E. amylovoraErwinia species"Some level of resistance"
PmrA/PmrB systemPhosphoethanolamine addition to LPSMultiple speciesVariable resistance levels

How does inhibition of ArnC affect bacterial susceptibility to different classes of antimicrobials?

Based on ArnC's role in the L-Ara4N modification pathway , inhibition would be expected to:

  • Increase susceptibility to polymyxins and other cationic antimicrobial peptides

  • Potentially sensitize bacteria to host immune defenses relying on cationic antimicrobial peptides

  • Have minimal direct effect on sensitivity to other antibiotic classes (β-lactams, aminoglycosides, etc.)

Similar to how rcs mutants in E. amylovora were "more susceptible to polymyxin B treatment than the wild-type" , arnC mutants would likely show increased sensitivity to polymyxins.

What are the optimal conditions for crystallizing membrane proteins like ArnC?

As an integral membrane glycosyltransferase , ArnC crystallization faces challenges common to membrane proteins:

  • Detergent selection is critical - typically a panel of detergents should be screened

  • Lipidic cubic phase crystallization may improve crystal quality

  • Addition of stabilizing ligands or substrates can enhance conformational homogeneity

  • Protein engineering (removal of flexible regions, addition of crystallization chaperones)

  • Nanobody-aided crystallization to stabilize specific conformations

How can cryo-electron microscopy advance structural understanding of ArnC?

For integral membrane proteins like ArnC , cryo-EM offers several advantages:

  • Visualization in more native-like environments (nanodiscs, amphipols)

  • Less protein material required compared to crystallography

  • Ability to capture multiple conformational states

  • Potential for higher resolution without need for crystallization

Methodological considerations include:

  • Reconstitution into nanodiscs or liposomes

  • Grid preparation optimization to overcome preferred orientation issues

  • Collection of large datasets to enable classification of conformational states

  • Computational approaches for membrane protein refinement

What assays can quantitatively measure ArnC enzymatic activity?

Based on ArnC's function of attaching formylated aminoarabinose to undecaprenyl phosphate , several assay approaches are possible:

  • Radiometric assays using labeled substrates

  • HPLC-based separation of substrates and products

  • Mass spectrometry to detect product formation

  • Coupled enzyme assays measuring reaction byproducts

  • Fluorescence-based assays with modified substrates or product-specific detection reagents

A table of potential assay approaches:

Assay TypeDetection MethodAdvantagesLimitations
RadiometricScintillation countingHigh sensitivityRequires radioactive materials
HPLCUV or fluorescence detectionDirect product quantificationLower throughput
Mass spectrometryDirect mass analysisDefinitive product identificationSpecialized equipment needed
Coupled enzymeSpectrophotometricContinuous monitoring possiblePotential interference from coupling enzymes
Fluorescence-basedPlate readerHigh throughputMay require substrate modification

How do substrate modifications affect ArnC catalytic efficiency?

While specific data on ArnC substrate specificity is not provided in the search results, researchers should consider:

  • Structure-activity relationship studies with modified undecaprenyl phosphate analogs

  • Variations in the aminoarabinose donor substrate

  • Competitive inhibition studies with substrate analogs

  • Effects of membrane environment on substrate presentation and enzyme activity

Can ArnC be engineered to accept alternative substrates for glycodiversification?

Based on ArnC's known glycosyltransferase activity , potential engineering approaches include:

  • Site-directed mutagenesis of the substrate binding pocket

  • Directed evolution to select for variants with altered specificity

  • Rational design based on structural information

  • Domain swapping with related glycosyltransferases

Successful engineering would require:

  • Sensitive high-throughput screening methods

  • Structural understanding of substrate recognition determinants

  • Methods to express and test large libraries of variants

What experimental approaches can validate in silico predictions of ArnC structure and function?

To validate computational predictions about ArnC:

  • Site-directed mutagenesis of predicted catalytic residues

  • Chemical modification of residues predicted to be critical for function

  • Cross-linking studies to validate predicted protein-substrate interactions

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Comparison of experimentally determined structures with predicted models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.