Recombinant Erwinia tasmaniensis Universal stress protein B (uspB)

What is Erwinia tasmaniensis Universal stress protein B (uspB) and what is its basic structure?

Erwinia tasmaniensis Universal stress protein B (uspB) is a full-length protein consisting of 111 amino acids. The protein is encoded by the uspB gene (also known as ETA_33190) and has the UniProt ID B2VHE5. The amino acid sequence of the recombinant protein is: MISTVSLFWALCVVCVINMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQVRLIGYIWAQRYLDHHDDEFIRRCQRVRGQFILTSALCGLVAIGLIGLAIWH .

For experimental applications, the recombinant protein is typically expressed with an N-terminal His tag in E. coli expression systems, which facilitates purification through affinity chromatography. The structural domains of uspB contribute to its function in stress response mechanisms, particularly important for bacterial adaptation to environmental changes.

How does Erwinia tasmaniensis differ from other Erwinia species, and what is the ecological significance of uspB?

Erwinia tasmaniensis is a Gram-negative, rod-shaped, motile bacterium that was isolated from apple flowers . Unlike pathogenic Erwinia species such as E. amylovora, E. tasmaniensis is considered an epiphytic species that shares the same host niche without causing disease .

The uspB protein plays a significant role in bacterial stress responses, particularly to environmental stressors common in plant surfaces. While pathogenic Erwinia species like E. amylovora cause fire blight disease in pome fruit trees, E. tasmaniensis has been studied for its potential beneficial interactions with host plants. Universal stress proteins, including uspB, are believed to contribute to bacterial survival under various stress conditions, making them particularly important in understanding how E. tasmaniensis persists epiphytically where pathogenic Erwinia species may also be present.

What expression systems are most effective for producing recombinant Erwinia tasmaniensis uspB protein?

E. coli expression systems represent the most widely used and effective method for producing recombinant Erwinia tasmaniensis uspB protein. The standard methodology involves:

• Cloning the full-length uspB gene (1-111aa) into an expression vector with an N-terminal His tag

• Transforming the construct into an appropriate E. coli strain optimized for protein expression

• Inducing protein expression under controlled conditions

• Purifying the recombinant protein using affinity chromatography

The resulting lyophilized protein typically achieves purity greater than 90% as determined by SDS-PAGE . For researchers seeking to optimize expression, consider the following parameters:

While E. coli remains the primary expression system, yeast-based systems may be considered for specific applications requiring eukaryotic post-translational modifications, though these are typically not necessary for the basic functional analysis of uspB.

How do the structural and functional characteristics of uspB in Erwinia tasmaniensis compare to universal stress proteins in related bacterial species?

The Universal stress protein B in Erwinia tasmaniensis shares significant structural and functional similarities with related proteins in the Erwinia genus, but with distinct features that reflect its ecological niche. Comparative analysis reveals:

• Sequence conservation: Alignment studies show that uspB maintains core domains characteristic of universal stress proteins while exhibiting species-specific variations in non-catalytic regions

• Functional domains: The protein contains conserved motifs associated with stress response mechanisms, particularly those active during oxidative stress and nutrient limitation

• Phylogenetic relationships: uspB in E. tasmaniensis appears to be more closely related to proteins in other epiphytic species than to those in pathogenic Erwinia species

Research indicates that while E. tasmaniensis shares genomic islands with pathogenic Erwinia species like E. amylovora, the specific modifications to proteins like uspB may contribute to its non-pathogenic nature. The horizontal gene transfer between Erwinia species appears to have contributed to the current diversity of uspB variants , with E. tasmaniensis maintaining stress response functions without virulence factors.

When studying the evolutionary relationships, researchers should consider:

• Focusing on protein domain architecture rather than whole-sequence identity

• Examining expression patterns under different stress conditions

• Investigating protein-protein interactions that may differ between pathogenic and non-pathogenic species

What role does uspB play in the CRISPR-Cas system of Erwinia species, and how might this impact experimental applications?

While uspB itself is not a direct component of the CRISPR-Cas system, research on Erwinia species has revealed important connections between stress response mechanisms and bacterial defense systems. The CRISPR-Cas system in Erwinia species functions as a significant defense mechanism against invasive genetic elements , and stress proteins like uspB may play regulatory roles in these defense responses.

Current research indicates:

• Stress conditions that activate uspB expression may also modulate CRISPR-Cas activity

• Universal stress proteins can influence bacterial physiological states that affect CRISPR-Cas efficiency

• When designing experiments involving phage resistance or plasmid maintenance in Erwinia species, researchers should account for potential interactions between stress response systems and CRISPR-Cas function

In experimental applications using recombinant uspB, researchers should:

• Monitor stress conditions that might activate CRISPR-Cas systems when studying plasmid stability

• Consider the impact of uspB overexpression on bacterial defense mechanisms

• Evaluate potential cross-talk between stress response pathways and CRISPR-Cas activity when interpreting results

The relationship between uspB and CRISPR-Cas is particularly relevant when studying E. tasmaniensis in its ecological context, as the bacterium shares ecological niches with pathogenic Erwinia species that have evolved different phage resistance mechanisms .

How can uspB be utilized in studies investigating bacterial adaptation to environmental stressors in plant-associated microbiomes?

Recombinant uspB provides a valuable tool for investigating bacterial stress responses in plant-associated microbiomes. The protein can be utilized in multiple experimental approaches:

• As a molecular marker for stress conditions in field samples

• In protein interaction studies to identify binding partners during stress response

• For generating antibodies to track native uspB expression in complex microbial communities

• As a standard in quantitative assays measuring stress response activation

When designing experiments to study bacterial adaptation using uspB:

The recombinant protein can serve as both an experimental tool and a reference standard when investigating how E. tasmaniensis and related species respond to changing environmental conditions in the plant phyllosphere. This application is particularly relevant given E. tasmaniensis's role as a non-pathogenic species sharing habitat with pathogenic Erwinia species .

What are the optimal storage and reconstitution conditions for maintaining uspB activity in laboratory experiments?

Maintaining optimal activity of recombinant uspB requires careful attention to storage and reconstitution protocols. Based on established methodologies:

For long-term storage:

• Store lyophilized powder at -20°C to -80°C

• Avoid repeated freeze-thaw cycles by preparing single-use aliquots

• For working stocks, store at 4°C for up to one week

For reconstitution:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (optimally 50%) for cryoprotection

• Prepare multiple small-volume aliquots to minimize freeze-thaw cycles

The storage buffer should be Tris/PBS-based with 6% Trehalose at pH 8.0 to maintain protein stability . Researchers should validate protein activity after reconstitution using appropriate functional assays, which may include:

• Binding assays with known interaction partners

• Structural analysis using circular dichroism

• Activity assays specific to stress-response functions

Monitoring protein stability over time through SDS-PAGE analysis is recommended, particularly when designing long-term experiments requiring consistent protein performance.

How should researchers design experiments to investigate uspB function in stress response pathways?

Designing robust experiments to investigate uspB function in stress response pathways requires multiple complementary approaches:

• Knockout/knockdown studies:

  • Generate uspB deletion mutants in E. tasmaniensis

  • Perform complementation with recombinant uspB

  • Assess phenotypic changes under various stress conditions

• Overexpression studies:

  • Express recombinant uspB in both homologous and heterologous systems

  • Monitor effects on stress tolerance

  • Identify potential dosage-dependent effects

• Stress condition testing panel:

• Protein interaction identification:

  • Co-immunoprecipitation with tagged uspB

  • Yeast two-hybrid screening

  • In vitro binding assays with potential partners

  • Cross-linking studies followed by mass spectrometry

When analyzing results, researchers should account for potential redundancy in stress response systems and consider the ecological context of E. tasmaniensis as an epiphytic bacterium adapted to plant surfaces. Comparison with stress responses in pathogenic Erwinia species can provide valuable insights into the specialized function of uspB in different ecological niches.

What controls and validations are essential when working with recombinant uspB in protein interaction studies?

When conducting protein interaction studies with recombinant uspB, implementing appropriate controls and validations is critical for generating reliable results:

Essential controls:

• Tag-only control: Express and purify the His-tag portion alone to identify non-specific interactions

• Denatured protein control: Use heat-denatured uspB to distinguish between specific and non-specific binding

• Competitive inhibition: Include excess unlabeled uspB to verify binding specificity

• Negative control proteins: Use unrelated proteins of similar size and charge characteristics

Validation methods:

• Reciprocal co-immunoprecipitation: Confirm interactions by pulling down with antibodies against both uspB and its putative partner

• Multiple detection methods: Verify interactions using at least two independent techniques (e.g., pull-down assays plus ELISA or surface plasmon resonance)

• Domain mapping: Identify specific interaction regions using truncated versions of uspB

• Functional validation: Demonstrate biological relevance of interactions through in vivo assays

When analyzing protein-protein interactions involving uspB, researchers should consider:

• The potential for conformation changes under different stress conditions

• How the His-tag might affect binding properties (N-terminal vs. C-terminal placement)

• The native oligomerization state of uspB, which may impact interaction studies

• Buffer conditions that mimic the bacterial periplasmic environment

Properly controlled interaction studies can provide valuable insights into how uspB functions within broader stress response networks in E. tasmaniensis and related bacteria.

How should researchers approach unexpected results when studying recombinant uspB function in stress response pathways?

When confronted with data that contradicts established hypotheses about uspB function, researchers should follow a systematic approach to analysis and interpretation:

• Examine the data thoroughly to identify specific discrepancies in the experimental results compared to expected outcomes .

• Evaluate the initial assumptions and experimental design, considering whether the hypothesis was based on:

  • Extrapolation from related but distinct proteins

  • Literature on universal stress proteins from distantly related species

  • Assumptions about stress response pathways that may not apply to E. tasmaniensis

• Consider alternative explanations:

  • Post-translational modifications affecting protein function

  • Unexpected cofactor requirements

  • Context-dependent activity based on cellular environment

  • Redundancy in stress response pathways masking phenotypes

• Refine variables and implement additional controls:

  • Test uspB function under more precisely defined stress conditions

  • Examine dose-dependency relationships

  • Investigate temporal aspects of uspB activity during stress response

When uspB fails to show expected activity or interactions, researchers should:

• Compare the recombinant protein structure to the native form

• Assess if the N-terminal His-tag affects function

• Consider whether E. coli-expressed protein lacks modifications present in E. tasmaniensis

• Evaluate buffer conditions that might not reflect the native environment

Unexpected results often lead to new discoveries about protein function, particularly for proteins like uspB that may have evolved species-specific functions in response to unique ecological pressures.

What analytical approaches are most effective for comparing uspB function across different Erwinia species?

Comparative analysis of uspB function across Erwinia species requires integrating multiple analytical approaches:

• Sequence-structure-function analysis:

  • Multiple sequence alignment of uspB homologs

  • Structural prediction and modeling

  • Identification of conserved vs. variable domains

  • Correlation of sequence differences with ecological niches

• Functional comparative assays:

• Evolutionary context analysis:

  • Examine horizontal gene transfer events that may have shaped uspB evolution

  • Analyze genomic islands containing uspB and related genes

  • Consider selective pressures from different host plants and environmental conditions

• Integration with genomic data:

  • Compare uspB genetic context across Erwinia genomes

  • Identify co-evolved genes that may function with uspB

  • Examine regulatory elements controlling uspB expression

When interpreting comparative data, researchers should consider that E. tasmaniensis, as a non-pathogenic species, may utilize uspB in ecological contexts distinct from pathogenic Erwinia species, despite sharing similar genomic elements through horizontal gene transfer .

How can researchers interpret uspB expression data in the context of broader stress response networks in Erwinia species?

Interpreting uspB expression data requires contextualizing it within the broader stress response networks operating in Erwinia species:

• Systems biology approach:

  • Map uspB expression patterns in relation to other stress response genes

  • Identify regulatory networks controlling uspB expression

  • Determine if uspB functions as a hub protein or specialized response element

  • Correlate expression with specific environmental triggers

• Temporal analysis:

  • Examine early vs. late stress response phases

  • Track uspB expression dynamics throughout stress exposure and recovery

  • Identify potential feedback mechanisms regulating expression

• Multi-omics integration:

  • Correlate transcriptomic data (uspB mRNA levels) with proteomic data (uspB protein abundance)

  • Integrate metabolomic data to identify downstream effects of uspB activity

  • Link uspB expression to phenotypic outcomes during stress

• Ecological context interpretation:

  • Compare expression patterns between laboratory conditions and field samples

  • Evaluate uspB expression in plant-associated biofilms vs. planktonic cultures

  • Consider how host plant conditions might influence uspB function in epiphytic bacteria

When analyzing data from epiphytic E. tasmaniensis compared to pathogenic Erwinia species, researchers should consider:

• How similar stress response mechanisms may serve different ecological functions

• Whether uspB participates in distinct protein interaction networks despite sequence similarity

• If uspB expression correlates with different phenotypic outcomes based on species lifestyle

The integration of uspB expression data with information about CRISPR-Cas systems and other defense mechanisms may reveal how stress response proteins contribute to bacterial adaptation in complex plant-associated microbiomes.