Recombinant Erythrobacter litoralis Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; ELI_01350; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Erythrobacter litoralis (strain HTCC2594)
Target Names
crcB
Target Protein Sequence
MSTLPPLYATLNVALGGAIGAVLRYQMGRWMTGWLGAPAMSVFPWATLAINALGSLLMGV LAGVLFKLSPGVQDQWRLLIGTGILGGFTTFSAFSLEVWVMVERGQPAFAALYVVLSVSL AISALVFGLMLTRLFA
Uniprot No.

Target Background

Function
CrcB plays a critical role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Erythrobacter litoralis Protein CrcB homolog and what is its function?

    The CrcB homolog from Erythrobacter litoralis (strain HTCC2594) is a membrane protein belonging to a widespread family of transporters involved in fluoride resistance. It consists of 136 amino acids (UniProt accession: Q2ND79) with multiple predicted transmembrane domains. CrcB proteins function as fluoride transporters that help reduce cellular concentrations of this anion, thereby mitigating its toxic effects. Research has demonstrated that CrcB proteins are essential for bacterial survival in environments with elevated fluoride levels. Experimental approaches to study CrcB function typically involve genetic knockout studies, which show increased fluoride sensitivity when the gene is deleted .

  • How is the expression of CrcB regulated in bacterial systems?

    In many bacterial and archaeal species, CrcB expression is regulated by fluoride-sensing riboswitches—RNA structures located in the messenger RNAs that control gene expression. These riboswitches selectively bind fluoride while rejecting other anions (including chloride) and undergo conformational changes upon fluoride binding. Using in-line probing methods, researchers have determined that the most conserved nucleotides of the fluoride riboswitch from Pseudomonas syringae undergo structural changes when fluoride binds, with an apparent dissociation constant (KD) of approximately 60 μM. This regulatory mechanism allows bacteria to detect toxic fluoride levels and respond by expressing proteins that counteract its harmful effects .

  • What is the amino acid sequence and structural characteristics of the E. litoralis CrcB protein?

    The complete amino acid sequence of E. litoralis CrcB is:
    MSTLPPLYATLNVALGGAIGAVLRYQMGRWMTGWLGAPAMSVFPWATLAINALGSLLMGVLAGVLFKLSPGVQDQWRLLIGTGILGGFTTFSAFSLEVWVMVERGQPAFAALYVVLSVSLAISALVFGLMLTRLA

    The protein contains multiple predicted transmembrane segments, consistent with its role as a membrane transporter. Evidence suggests that CrcB functions as a dimer with dual membrane topology, similar to several small multidrug transporters. While no high-resolution structure exists for E. litoralis CrcB, computational predictions and experimental evidence from related proteins indicate it adopts a structure optimized for selectively transporting fluoride ions across the cell membrane .

  • How are CrcB proteins conserved across different species?

    CrcB proteins are highly conserved and widely distributed across bacterial and archaeal species, with homologs also present in eukaryotic lineages such as fungi and plants. In eukaryotes, these homologs have been renamed FEX (fluoride exporters). Despite considerable variation in amino acid sequences, their functional role in fluoride resistance appears to be maintained, suggesting strong evolutionary pressure for this protection mechanism. Comparative genomic analyses indicate that different bacterial species may have either CrcB or EriCF proteins (another class of fluoride transporters), but rarely both, suggesting they serve equivalent functions in fluoride detoxification .

  • What experimental methods are available for producing recombinant E. litoralis CrcB protein?

    For recombinant production of E. litoralis CrcB, researchers typically use E. coli expression systems with appropriate vectors containing the crcB gene. The recombinant protein can be produced with various tags to facilitate purification, though the specific tag is often determined during the production process based on optimal expression and solubility. For storage and stability, the purified protein is recommended to be kept in a Tris-based buffer with 50% glycerol at -20°C or -80°C. For extended usage, working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein stability and activity .

Advanced Research Questions

  • What methodologies can be used to assess CrcB-mediated fluoride transport?

    Multiple experimental approaches can be employed to assess CrcB-mediated fluoride transport:

    MethodologyApplicationAdvantagesLimitations
    Growth inhibition assaysCompare wild-type and crcB knockout strains at various fluoride concentrationsSimple, quantitative, physiologically relevantIndirect measure of transport
    Reporter gene assaysMonitor cellular response using fluoride-responsive riboswitchesCan detect real-time changes in vivoMay be affected by other cellular factors
    Fluoride-selective electrodesDirect measurement of fluoride effluxQuantitative, continuous monitoringRequires specialized equipment
    Fluorescent probesVisualize transport in real-timeSpatial information within cellsLimited sensitivity, potential probe artifacts
    Liposome reconstitutionStudy transport in a defined membrane systemControlled environment for mechanistic studiesComplex preparation, artificial system
    ElectrophysiologyMeasure fluoride conductance across membranesDirect biophysical measurementsTechnically challenging, specialized expertise

    Selection of appropriate methods depends on the specific research question, available resources, and the desired level of mechanistic detail .

  • How does the Erythrobacter litoralis system compare to other model systems for studying fluoride resistance?

    E. litoralis has emerged as a valuable model system for studying fluoride resistance mechanisms. The genome of E. litoralis DSM 8509 has been completely sequenced and closed, providing a comprehensive genetic foundation for research. This species has been developed as a genetic model with established protocols for transformation via both electroporation and conjugation, along with methods for generating unmarked gene deletions and allele replacements. Unlike some other Erythrobacter strains that contain multiple LOV-HWE kinases, DSM 8509 contains a single LOV-HWE histidine kinase gene, simplifying certain signaling studies. This system complements other established models such as E. coli (where crcB knockout strains show clear fluoride sensitivity phenotypes) and eukaryotic systems like Neurospora crassa and Saccharomyces cerevisiae (where FEX genes mediate fluoride resistance) .

  • What is the relationship between CrcB function and general stress response in Erythrobacter litoralis?

    In E. litoralis, the general stress response (GSR) system is regulated by an extracytoplasmic function (ECF) sigma factor called σEcfG, which activates transcription in response to various stressors. The regulation involves HWE/HisKA_2-family histidine kinases, including sensor kinases like GsrK, LovK, and GsrP. While direct links between CrcB and these GSR regulators have not been fully characterized, both systems respond to environmental stressors. E. litoralis has been developed as a genetic model to study GSR regulation, particularly the role of photosensory regulation, as visible light serves as a GSR regulatory signal with higher transcription observed in dark conditions. Understanding the potential cross-talk between fluoride stress response mediated by CrcB and the broader GSR network represents an important area for future research .

  • How do researchers identify critical functional residues in CrcB proteins?

    Identification of critical functional residues in CrcB proteins typically employs a multi-faceted approach:

    1. Comparative sequence analysis across diverse species to identify highly conserved residues

    2. Site-directed mutagenesis targeting conserved or charged residues, particularly those within predicted transmembrane domains

    3. Structure-function studies using both alanine substitutions (to assess importance of side chains) and conservative substitutions (to probe specific chemical properties)

    4. Functional complementation assays in crcB knockout strains to assess the impact of mutations on fluoride resistance

    5. Direct transport measurements to quantify the effect of mutations on fluoride transport kinetics

    6. Computational modeling to predict interaction sites with fluoride ions

    7. Evolutionary analysis to identify residues under positive selection

    These approaches, used in combination, help elucidate the molecular basis of fluoride selectivity and transport .

  • What are the challenges and solutions in studying membrane proteins like CrcB?

    Membrane proteins like CrcB present several research challenges:

    1. Expression and purification difficulties due to hydrophobicity and potential toxicity to host cells

    2. Proper membrane insertion and folding in heterologous systems

    3. Maintaining native structure during solubilization and purification

    4. Low expression yields compared to soluble proteins

    5. Challenges in crystallization for structural studies

    Researchers address these challenges through:

    1. Optimizing expression conditions (temperature, inducer concentration)

    2. Using specialized host strains designed for membrane protein expression

    3. Employing fusion tags to improve solubility and expression

    4. Developing mild solubilization protocols with appropriate detergents

    5. Utilizing alternative structural techniques such as cryo-electron microscopy

    6. Implementing stabilizing agents like glycerol in storage buffers

    7. Reconstituting proteins in nanodiscs or liposomes for functional studies

    For E. litoralis CrcB specifically, storage in Tris-based buffer with 50% glycerol at -20°C or -80°C is recommended to maintain stability .

  • How does the ecological niche of Erythrobacter litoralis influence its fluoride resistance mechanisms?

    E. litoralis is an aerobic anoxygenic photoheterotrophic (AAP) bacterium isolated from marine environments, specifically from a cyanobacterial mat in the supralittoral zone. This ecological context may influence its fluoride resistance mechanisms in several ways. Marine environments can contain variable levels of fluoride, necessitating adaptive responses. As a photoheterotrophic organism, E. litoralis has specialized metabolic capabilities that may interact with its stress response systems. The photobiology of E. litoralis, including its light-sensing mechanisms through proteins like LovK (a blue-light photosensor kinase), may indirectly influence fluoride resistance pathways. The general stress response in E. litoralis is known to be regulated differently in light versus dark conditions, with higher GSR transcription in the dark. Understanding how these ecological adaptations interface with fluoride resistance mechanisms represents an important area for integrative research .

  • What recent advances have been made in understanding the structural basis of CrcB function?

    Although high-resolution structural data for E. litoralis CrcB is currently lacking, research on related fluoride transporters has provided insights into potential structural mechanisms. CrcB proteins are predicted to have multiple transmembrane domains and likely function as dimers. Evidence suggests a dual membrane topology similar to small multidrug transporters. The highly conserved nature of key residues across diverse species indicates functional constraints on the structure. While detailed atomic-level mechanisms remain to be elucidated, the selective transport of fluoride (which has a smaller ionic radius of 0.133 nm compared to chloride at 0.181 nm) suggests structural features that discriminate based on ion size and hydrogen-bonding properties. Some studies suggest that CrcB may utilize magnesium ions to form bridging contacts between the anionic fluoride and nucleotides, though this mechanism requires further investigation. Ongoing research using techniques like cryo-electron microscopy and computational modeling continues to advance our understanding of CrcB structure-function relationships .

  • How can CrcB homologs be identified in genomic datasets?

    Identification of CrcB homologs in genomic datasets can be approached through multiple complementary strategies:

    1. Sequence similarity searches using BLAST with known CrcB sequences as queries

    2. Position-specific scoring matrices (PSSMs) or hidden Markov models (HMMs) built from aligned CrcB sequences

    3. Genomic context analysis, focusing on genes associated with fluoride riboswitches

    4. Searching for the conserved CrcB domain (Pfam: PF02537)

    5. Identification of proteins with similar predicted membrane topology (4-5 transmembrane segments)

    6. For distant homologs, employing sensitive profile-profile comparison methods

    7. In eukaryotes, specifically searching for FEX family members, which are functional homologs

    Comprehensive identification typically combines multiple approaches, followed by functional validation through complementation studies or fluoride resistance assays .

  • What is the relationship between CrcB and other fluoride resistance mechanisms?

    Fluoride resistance in microorganisms involves multiple mechanisms beyond CrcB:

    1. EriCF proteins: An alternative class of fluoride transporters that appear functionally equivalent to CrcB, as species rarely encode both

    2. Enzymes resistant to fluoride inhibition: Some fluoride riboswitch-associated genes encode variants of enzymes known to be inhibited by fluoride

    3. Riboswitch-mediated regulation: Controls expression of multiple fluoride resistance genes

    4. FEX proteins: Eukaryotic homologs of CrcB that mediate fluoride export

    These mechanisms likely evolved independently in response to the widespread occurrence of fluoride in the environment and its toxic effects on cellular processes. The distribution of different fluoride resistance mechanisms across species suggests adaptation to specific ecological niches. For example, the pathogenic bacterium Streptococcus mutans (a causative agent of dental caries) encodes EriCF proteins in the same genomic location where other Streptococcus species encode CrcB proteins, highlighting the importance of fluoride resistance for this organism that frequently encounters fluoride in the oral environment .

  • What are the current gaps in understanding CrcB function and fluoride resistance?

    Despite significant advances, several knowledge gaps remain in CrcB research:

    1. The precise molecular mechanism of fluoride transport (channel vs. carrier, energy coupling)

    2. High-resolution structural information for CrcB family members

    3. The complete interactome of CrcB proteins within cellular networks

    4. Species-specific adaptations in CrcB function related to ecological niches

    5. Integration of CrcB-mediated fluoride resistance with other stress response pathways

    6. Potential secondary functions beyond fluoride transport

    7. Evolutionary history and diversification of the CrcB/FEX family

    8. The full complement of proteins involved in fluoride homeostasis

    9. Regulation beyond riboswitches in diverse species, particularly in eukaryotes

    10. Physiological significance of fluoride resistance in different environmental contexts

    Addressing these gaps will require integrated approaches combining structural biology, genetics, biochemistry, and ecological studies to fully understand the biological significance and mechanisms of CrcB-mediated fluoride resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.