Recombinant Erythrobacter litoralis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Function

Undecaprenyl-diphosphatase (uppP), classified under EC 3.6.1.27, catalyzes the hydrolysis of undecaprenyl diphosphate (C55-PP) to undecaprenyl phosphate (C55-P), releasing inorganic phosphate . This reaction is essential for recycling the lipid carrier molecule used in peptidoglycan synthesis, O-antigen assembly, and other glycan transport processes in bacteria .

Key Reaction:

undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate}

Enzymatic activity is enhanced by divalent cations like Ca2+^{2+} .

Role in Antibiotic Resistance

uppP is implicated in bacitracin resistance by recycling undecaprenyl phosphate, which is sequestered by bacitracin . Studies on E. litoralis HTCC2594 highlight:

  • Genetic Stability: Unlike plasmid-borne resistance genes (e.g., blaNDM-1), uppP in E. litoralis lacks mobile genetic elements, reducing horizontal transfer risk .

  • Stress Response: SigM-regulated pathways in bacteria prioritize uppP activity to maintain peptidoglycan synthesis under lipid carrier depletion .

Research Applications

  • Enzymatic Assays: Used to study undecaprenyl phosphate metabolism in Gram-negative bacteria .

  • Antibiotic Development: Targeted in drug discovery to disrupt cell wall synthesis pathways .

  • Comparative Genomics: Genome-wide studies of Erythrobacter spp. reveal uppP conservation across phototrophic and non-phototrophic strains .

Evolutionary and Ecological Significance

  • Phylogeny: uppP genes in Erythrobacter share >94% 16S rRNA similarity but exhibit functional divergence in phototrophic vs. heterotrophic strains .

  • Environmental Distribution: Metagenomic data suggest uppP-like enzymes are widespread in marine ecosystems, particularly in nutrient-rich coastal waters .

Key Research Challenges

  • Mechanistic Gaps: The precise regulation of uppP activity in E. litoralis remains uncharacterized.

  • Biotechnological Potential: Engineering uppP for enhanced lipid carrier recycling could improve bacterial chassis for synthetic biology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize development according to your specifications.
Synonyms
uppP; ELI_12065; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Erythrobacter litoralis (strain HTCC2594)
Target Names
uppP
Target Protein Sequence
MTFLQLLIIAVVQGITEFLPISSSGHLILIPNFTEFPDQGPLIDVAVHVGSLLAIIVYFF KDVLTLARGGFASIGIGTDRPDAPSERRLFWWIVLGTIPAVAFGLAIKLGAFNSIAETWF NITVIDDDLMSSIRFTDLIAFNLIVYGIALGLADWLGKEVKKFEDMSWRDGLIVGIAQAL AIIPGTSRSGVTMTAARALGYSRYESARFSFLLSIPAVAGAGVLIVPEIFEAGATLAMDA LIAGVLTFIAAFLTMAFLMNFLKRASMLVFVFYRVAMGCALLAFF
Uniprot No.

Target Background

Function
This enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). It confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its primary function?

Undecaprenyl-diphosphatase (uppP, EC 3.6.1.27) is an integral membrane enzyme that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This reaction is essential for bacterial cell growth due to its role in the formation of bacterial cell wall peptidoglycan . In Erythrobacter litoralis (strain HTCC2594), uppP (UniProt ID: Q2N736) is also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase . The enzyme contains 285 amino acids and functions as a key component in maintaining cell wall integrity .

How does uppP contribute to bacterial cell wall synthesis?

The bacterial cell wall synthesis depends on the lipid II cycle, where undecaprenyl phosphate (UP) serves as a carrier molecule essential for peptidoglycan biosynthesis . UppP plays a vital role in this cycle by converting UPP back to UP, thereby enabling the continued synthesis of the cell wall components . Studies in Bacillus subtilis have demonstrated that depletion of UPP phosphatase activity leads to severe morphological defects consistent with failure of cell envelope synthesis, highlighting the critical nature of this conversion step . The lipid carrier UP is required for the initial stages of peptidoglycan synthesis, making the recycling pathway maintained by uppP indispensable for bacterial viability .

What is the relationship between uppP and antibiotic resistance?

UppP, which is also known as bacitracin resistance protein, contributes to antibiotic resistance by maintaining the supply of UP needed for cell wall synthesis even in the presence of antibiotics that target this pathway . Bacitracin is an antibiotic that binds tightly to the pyrophosphate group on surface-exposed UPP, preventing its recycling and thus inhibiting cell wall synthesis . In B. subtilis, studies have shown that while deletion of uppP alone had no measurable effect on bacitracin minimal inhibitory concentration (MIC), combined limitations in UPP phosphatase activity (through deletion or depletion of both uppP and bcrC) dramatically reduced bacitracin resistance . This demonstrates the redundant but essential nature of UPP phosphatases in antibiotic defense mechanisms.

How does the membrane localization of uppP affect its functionality?

The membrane localization of uppP is critical for its function due to the hydrophobic nature of its substrate. UPP is embedded in the bacterial membrane with its pyrophosphate group accessible for enzymatic action . The transmembrane domains of uppP position the catalytic site optimally to access the pyrophosphate moiety while accommodating the long undecaprenyl tail within the membrane environment. This strategic positioning allows uppP to efficiently catalyze the dephosphorylation reaction without removing the substrate from the membrane, maintaining the spatial organization necessary for the lipid II cycle to continue .

What are the optimal conditions for expressing recombinant E. litoralis uppP?

Based on available information about membrane protein expression and specific details for E. litoralis uppP, the following parameters should be considered for optimal expression:

ParameterRecommended Conditions
Expression systemE. coli BL21(DE3) or C41/C43 strains (specialized for membrane proteins)
Expression vectorpET-based with appropriate fusion tags (His6 recommended for purification)
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8
Temperature16-25°C for induction (lower temperatures favor proper folding)
Duration16-24 hours for extended expression at lower temperatures
MediaRich media (2xYT or TB) with appropriate antibiotics

The commercial preparation of E. litoralis uppP indicates that optimal storage conditions include a Tris-based buffer with 50% glycerol, suggesting these components help maintain protein stability . Small-scale expression trials with varying conditions should be conducted to determine the optimal parameters for functional protein production.

What assays can be used to measure uppP enzymatic activity?

Several complementary approaches can be employed to measure UPP phosphatase activity:

  • Colorimetric phosphate release assay:

    • Incubate purified uppP with UPP substrate

    • Detect released inorganic phosphate using malachite green or other phosphate-detection reagents

    • Quantify via spectrophotometric measurement at appropriate wavelength

  • Radiolabeled substrate assay:

    • Use 32P-labeled UPP as substrate

    • Separate substrate and product by thin-layer chromatography

    • Quantify via autoradiography or scintillation counting

  • HPLC or LC-MS based methods:

    • Direct separation and quantification of UPP and UP

    • Higher specificity but requires specialized equipment

    • Can be used to determine kinetic parameters

These methods can be adapted to determine the effects of inhibitors, pH, temperature, and ionic conditions on enzyme activity, providing insights into the catalytic mechanism of uppP.

How can the functional effects of uppP be studied in bacterial systems?

To study the functional effects of uppP in bacterial systems, researchers can employ several approaches:

  • Genetic manipulation techniques:

    • Gene deletion or knockdown using CRISPRi (as demonstrated in B. subtilis studies)

    • Complementation studies with wild-type or mutant uppP variants

    • Synthetic lethality testing with other UPP phosphatases (e.g., bcrC)

  • Phenotypic characterization:

    • Microscopy to assess morphological changes

    • Growth curve analysis under normal and stress conditions

    • Antibiotic susceptibility testing, particularly with cell wall-targeting antibiotics

  • Molecular readouts:

    • Reporter gene assays to monitor cell envelope stress responses

    • Quantification of cell wall precursors and intermediates

    • Transcriptomic or proteomic analysis of compensatory responses

These approaches can reveal the physiological importance of uppP and its role in maintaining bacterial cell wall integrity under various environmental conditions.

What is the significance of E. litoralis as a model organism for studying uppP?

Erythrobacter litoralis is among the more commonly cultured bacteriochlorophyll a (BChl-a) containing aerobic anoxygenic phototrophs . This unique physiological characteristic makes it an interesting model for studying uppP in the context of photosynthetic bacteria:

  • The photosynthetic capabilities of E. litoralis may impose specific requirements on cell envelope integrity and composition, potentially influencing uppP function and regulation.

  • As a marine bacterium, E. litoralis faces different environmental challenges compared to soil bacteria like B. subtilis, which might be reflected in adaptations of its cell wall biosynthesis machinery.

  • Comparative studies between photosynthetic and non-photosynthetic bacteria could reveal whether uppP function is influenced by or integrated with photosynthetic metabolism.

  • The frequent isolation of Erythrobacter species makes them experimentally accessible models for studying less common bacterial physiologies .

How can uppP be targeted for novel antibiotic development?

UPP phosphatases represent promising targets for antibiotic development due to their essential role in bacterial cell wall biosynthesis . Several strategies could be employed:

  • Direct inhibition approach:

    • Design of small molecules that compete with UPP for the enzyme active site

    • Development of non-hydrolyzable UPP analogs that bind irreversibly

    • Structure-based design targeting unique features of bacterial UPP phosphatases

  • Synergistic approach:

    • Development of compounds that potentiate the activity of existing antibiotics like bacitracin

    • Dual-targeting strategies affecting multiple steps in the lipid II cycle

    • Compounds that prevent upregulation of bcrC or other compensatory mechanisms

  • Screening methods:

    • High-throughput screening of compound libraries against purified uppP

    • Whole-cell screening with reporter systems that detect cell wall stress

    • CRISPRi-based methods to identify potential inhibitors, as demonstrated for UppS

The search results indicate that major pharmaceutical companies have previously pursued UPP phosphatases as targets, suggesting their recognized potential in antibiotic development .

What are the challenges in studying E. litoralis uppP at the molecular level?

Several challenges exist in the molecular study of E. litoralis uppP:

  • Membrane protein difficulties:

    • Expression and purification challenges common to integral membrane proteins

    • Maintaining native conformation and activity during extraction and analysis

    • Requirement for detergents or membrane mimetics for functional studies

  • Substrate availability:

    • Limited commercial availability of the natural substrate (UPP)

    • Need to synthesize or extract UPP for enzymatic studies

    • Ensuring substrate presentation in a membrane-like environment

  • Functional redundancy:

    • Potential presence of multiple UPP phosphatases with overlapping functions

    • Need for conditional knockout or depletion strategies to study essential genes

    • Distinguishing uppP-specific effects from general UPP phosphatase deficiency

  • Species-specific considerations:

    • Genetic tools for E. litoralis may be less developed than for model organisms

    • Unique growth requirements based on its photosynthetic and marine nature

    • Potential differences in membrane composition affecting enzyme function

How does RNA analysis contribute to understanding uppP function in bacterial communities?

RNA-based approaches provide valuable insights into active uppP expression in bacterial communities:

  • Transcriptional activity detection:

    • RNA is highly labile and typically has a half-life of only a few minutes

    • rRNA levels correlate with cellular activity, allowing identification of metabolically active cells

    • mRNA analysis indicates active gene expression rather than merely the presence of the gene

  • Reverse transcription PCR (RT-PCR):

    • Can be used to investigate gene expression and identify active AAP bacteria, including Erythrobacter species

    • Provides a strong indication of specific gene expression at the time of sampling

    • Helps distinguish between dormant and actively metabolizing bacterial populations

  • Environmental context:

    • RNA analysis can reveal how environmental factors influence uppP expression

    • Allows correlation between environmental stressors and changes in cell wall metabolism

    • Provides insights into the ecological significance of uppP in natural bacterial communities

These approaches help determine how uppP expression varies across different growth conditions and environmental challenges, complementing genomic and biochemical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.