Recombinant Erythrocebus patas Melanocyte-stimulating hormone receptor (MC1R)

What is MC1R and what are its primary functions in mammalian systems?

MC1R (Melanocortin 1 Receptor) is a 7-transmembrane G-protein-coupled receptor with two alternatively spliced variants that plays a critical role in pigmentation. In melanocytes, MC1R regulates the proportion of pheomelanin to eumelanin, which determines skin and hair color characteristics . The receptor functions by responding to melanocyte-stimulating hormone (MSH); when activated, it stimulates cAMP production leading to increased eumelanin synthesis .

Functionally, MC1R mutations have been extensively documented across species. In humans, these mutations are associated with red hair and light skin that tans poorly or not at all . Similar findings have been observed in animals, where MC1R mutations correlate with red coat coloration .

Beyond pigmentation, MC1R has been implicated in melanoma susceptibility through both pigmentation-dependent and independent pathways. Research indicates that inherited variation at the MC1R gene may influence melanoma risk through biological mechanisms not directly related to pigmentation phenotypes .

How do common MC1R variants differ in their functional impact?

MC1R variants are typically classified as either strong ("R") or weak ("r") alleles based on their association with the red hair phenotype. Major R alleles include p.D84E, p.R142H, p.R151C, p.I155T, p.R160W, and p.D294H, while other nonsynonymous variants are classified as r alleles .

These variants differ functionally in their ability to stimulate cAMP after MSH binding. Loss-of-function variants of MC1R are unable to properly stimulate cAMP after stimulation with MSH, resulting in reduced eumelanin synthesis in melanocytes . For example, the R151C variant (a base change at position 451 (C→T)) results in an arginine to cysteine substitution at codon 151 in the second intracellular loop of the protein, while the R160W variant (a base change at position 478 (C→T)) leads to an arginine to tryptophan substitution at codon 160 .

Compound heterozygotes carrying different variants show more pronounced phenotypic effects. For instance, one case study identified an individual with both the paternal R151C change and the maternal R160W change, demonstrating how multiple MC1R variations can interact to produce distinctive phenotypic outcomes .

What experimental models are available for studying MC1R function?

Several experimental models have proven valuable for MC1R research:

• CRISPR/Cas9 Knockout Models: Animal models with MC1R gene deletions provide insights into phenotypic changes. In rabbits, MC1R knockout resulted in a novel pale-yellow coat color due to absent eumelanin in hair follicles . Histological H&E staining confirmed the absence of eumelanin in hair follicles of MC1R-knockout rabbits compared to wild-type controls .

• Recombinant Protein Systems: Expression of recombinant MC1R proteins enables biochemical and structural studies. Full-length Erythrocebus patas MC1R protein (317 amino acids) has been successfully produced with N-terminal His tags in E. coli expression systems, resulting in >90% purity suitable for research applications .

• Clinical Trial Models: Human subjects in melanoma-focused trials provide opportunities to study MC1R in clinical contexts. Recent first-in-human trials studied MC1R-targeted imaging tracers ([203Pb]VMT01 and [68Ga]VMT02) in stage IV melanoma patients, correlating imaging results with immunohistochemistry of MC1R expression in tumor biopsies .

• Genetic Association Studies: Human populations with characterized MC1R variants allow investigation of genotype-phenotype relationships and disease associations, particularly regarding melanoma risk and survival outcomes .

How can genome-specific manipulation of MC1R be optimized for functional studies?

Genome-specific manipulation is crucial for exploring MC1R function and providing insights into coat color mechanisms. For optimal MC1R targeting:

• sgRNA Design Strategy: When targeting MC1R with CRISPR/Cas9, a dual sgRNA approach targeting the coding sequence has proven highly effective. In rabbit studies, researchers designed sgRNAs that specifically avoided natural deletion regions in the MC1R gene, achieving 85.7% editing efficiency in blastocysts .

• Verification Methods:

  • PCR genotyping using specific primers (e.g., MC1R-F: 5′-GGTGGCTGGTGTGGAAATGT-3′ and MC1R-R: 5′-GCTGGCAAAGGGGCACTA-3′)

  • Cloning PCR products into vectors (such as pEASY-blunt simple vector) for Sanger sequencing

  • Sequence alignment against wild-type alleles to identify mutations

• Functional Assessment:

  • Histological examination to assess melanin production in hair follicles

  • qPCR analysis of downstream genes in the MC1R pathway including MITF, TYR, TYRP1, and DCT

  • 3D protein structure modeling using programs like Phyre2 to predict the impact of targeted modifications

This approach has successfully generated novel phenotypes, such as pale-yellow coat color in rabbits due to blocked eumelanin synthesis, demonstrating the powerful utility of genome-specific manipulation for MC1R functional studies .

What methods are most effective for characterizing MC1R variants in clinical samples?

Comprehensive characterization of MC1R variants in clinical samples requires a multi-faceted approach:

• Genomic Analysis Pipeline:

  • DNA extraction from peripheral blood or tissue biopsies

  • PCR amplification of the MC1R gene using specific primers

  • Sequencing of PCR products (Sanger sequencing for targeted analysis or next-generation sequencing for comprehensive screening)

  • Variant classification into functional categories (R or r alleles) based on established criteria

• Expression Analysis:

  • Immunohistochemistry to detect MC1R protein levels and localization in tumor samples

  • Correlation of IHC results with imaging findings to validate MC1R as a biomarker

• Clinical Correlation Approaches:

  • Statistical analysis using COX regression models for survival outcomes

  • Risk assessment models incorporating MC1R genotype alongside clinical risk factors

  • Evaluation of melanoma risk prediction with and without MC1R inclusion

The integration of these methodologies allows researchers to establish meaningful connections between MC1R genetic variants and clinical outcomes, particularly in the context of melanoma risk assessment and prognosis prediction .

How can MC1R-targeted imaging agents be developed and validated for melanoma research?

Development of MC1R-targeted imaging agents represents a promising approach for melanoma detection and treatment monitoring. The validation process involves multiple stages:

• Agent Development and Selection:

  • Design of novel MC1R-targeted imaging tracers with appropriate radioisotopes ([203Pb] for SPECT/CT, [68Ga] for PET/CT)

  • Optimization of molecular properties for tumor penetration and retention

• Clinical Validation Protocol:

  • Patient selection criteria including stage IV melanoma with positive [18F]FDG PET/CT within 30 days of imaging tracer injection

  • Administration protocol: 555-925 mBq of [203Pb]VMT01 for SPECT/CT imaging at 1, 4, and 24 hours

  • For PET imaging: 74-277 mBq [68Ga]VMT02 with dynamic imaging up to 1 hour, and at 2 and 3 hours

  • Blinded review by experienced radiologists comparing experimental imaging to standard [18F]FDG PET/CT

• Correlation with Biological Markers:

  • Obtaining melanoma biopsy tissue for MC1R immunohistochemistry

  • Definition of imaging positivity as tumor uptake and retention of tracer above background liver activity

  • Comparative analysis of imaging results with histological MC1R expression

First-in-human clinical trial results showed that 3 of 6 imaged subjects had MC1R-positive tumors via experimental imaging tracers, with [68Ga]VMT02 PET/CT at 3 hours providing the best tumor-to-background ratio . These findings establish a foundation for developing MC1R-targeted therapeutic approaches.

How should researchers interpret MC1R variant effects on melanoma risk and survival?

Interpreting MC1R variant effects on melanoma requires sophisticated analytical approaches to distinguish direct from indirect effects:

• Differentiating Pathway Effects:

  • Separate MC1R effects into pigmentation-dependent (indirect) and pigmentation-independent (direct) pathways

  • Use statistical mediation analysis to quantify these distinct contributions to melanoma risk

• Risk Prediction Modeling:

  • Compare base clinical prediction models (age, sex, sunburn, nevi count, phenotype) with models incorporating MC1R variants

  • Evaluate model improvements when adding MC1R genotype information (any variant vs. wild-type, r variants only, at least one R variant)

  • Assess prediction performance in subgroups, such as individuals without red hair phenotype

• Survival Analysis Considerations:

  • Apply COX regression models for determining hazard ratios in survival analyses

  • Account for gender differences, as MC1R variants may lead to worse prognosis specifically among male patients

  • Consider population-specific effects, as MC1R impact on disease course varies across different study cohorts

Current evidence suggests MC1R's effect on melanoma outcomes is not consistently strong and may vary by population . Subgroup analysis indicates MC1R may have a stronger role in melanoma prediction for participants without the red hair phenotype, highlighting the importance of considering both genetic and phenotypic factors in comprehensive risk assessment .

What techniques are essential for characterizing recombinant MC1R protein structure and function?

Comprehensive characterization of recombinant MC1R proteins requires multiple complementary techniques:

• Structural Analysis Methods:

  • 3D modeling using programs like Phyre2 to predict protein structure

  • Comparative analysis of wild-type and variant MC1R proteins to identify conformational changes

  • Assessment of transmembrane domains and ligand-binding regions

• Functional Evaluation Approaches:

  • Receptor-ligand binding assays to measure affinity for melanocortin peptides

  • cAMP signaling assays to assess downstream activation potential

  • Comparison between wild-type and variant forms to quantify functional differences

• Quality Assessment Parameters:

  • Purity verification (>90%) using SDS-PAGE

  • Sequence confirmation with techniques like mass spectrometry

  • Proper folding assessment through activity-based assays

For recombinant Erythrocebus patas MC1R specifically, the full-length protein (317 amino acids) with N-terminal His tag has been successfully expressed in E. coli and purified to research-grade quality . The amino acid sequence (MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVVTAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSMLFIAYYDHAA VLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPAHQSFGLKGAATLTILLGIFFLCWGPFFLHLTL IVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAFRSQELRRTLKEVLLCSW) represents the complete functional receptor, enabling detailed structure-function studies .

How can researchers effectively analyze downstream pathway changes following MC1R modification?

Analysis of downstream MC1R signaling requires integrated methodological approaches:

• Transcriptomic Analysis:

  • qPCR evaluation of key downstream genes including MITF (microphthalmia-associated transcription factor), TYR (tyrosinase), TYRP1 (tyrosinase-related protein 1), and DCT (dopachrome tautomerase)

  • Normalization to housekeeping genes like GAPDH using the 2-ΔΔCT formula

  • Comparative analysis between modified MC1R and wild-type controls

• Phenotypic Outcome Assessment:

  • Histological examination (H&E staining) to evaluate melanin production in tissues

  • Quantification of eumelanin amounts in hair follicles or other relevant tissues

  • Macroscopic phenotype evaluation (e.g., coat color changes in animal models)

• Integrated Pathway Analysis:

  • Correlation between gene expression changes and phenotypic outcomes

  • Identification of compensatory mechanisms in response to MC1R modification

  • Mapping of signaling network alterations using systems biology approaches

In MC1R-knockout rabbits, mRNA levels of downstream genes in the MC1R pathway (MITF, TYR, TYRP1, DCT) were all downregulated compared to wild-type controls, corresponding with the absence of eumelanin in hair follicles and the resulting pale-yellow coat color . This multi-level analysis approach demonstrates how comprehensive assessment of downstream pathways can elucidate the functional consequences of MC1R modifications.

How can MC1R genotyping improve melanoma risk prediction and clinical management?

MC1R genotyping offers significant potential for enhancing melanoma risk stratification and clinical management:

• Risk Prediction Enhancement:

  • Incorporation of MC1R genotype alongside clinical risk factors (age, sex, sunburn history, nevi count, phenotype) improves prediction models

  • Evaluation of specific variant types (R vs. r alleles) provides more nuanced risk assessment

  • Subgroup-specific risk assessment, particularly valuable for individuals without obvious phenotypic risk factors like red hair

• Clinical Decision Support:

  • Stratified screening protocols based on combined genetic and phenotypic risk profiles

  • Personalized prevention recommendations tailored to MC1R status

  • Targeted surveillance strategies for high-risk variant carriers

• Survival Prognostication:

  • Analysis of MC1R variants in relation to 10-year survival outcomes after melanoma diagnosis

  • Gender-specific prognostic considerations, as MC1R effects may differ between male and female patients

  • Population-specific interpretation, acknowledging that MC1R effects may vary across different geographic or ethnic groups

What role does MC1R play in targeted imaging and therapeutic approaches for melanoma?

MC1R shows significant promise as a target for both diagnostic imaging and therapeutic development in melanoma:

• Diagnostic Imaging Applications:

  • Development of MC1R-targeted imaging tracers like [203Pb]VMT01 for SPECT/CT and [68Ga]VMT02 for PET/CT

  • First-in-human clinical trials demonstrating feasibility of MC1R-targeted imaging in stage IV melanoma patients

  • Optimization of imaging protocols with [68Ga]VMT02 PET/CT at 3 hours providing best tumor-to-background ratio and [203Pb]VMT01 SPECT/CT showing tumor retention at 24 hours

• Patient Selection Strategy:

  • Correlation between imaging positivity (defined as tumor uptake and retention of tracer above background liver activity) and MC1R expression by immunohistochemistry

  • Identification of suitable patients for MC1R-targeted therapeutic approaches

  • Integration with conventional imaging modalities like [18F]FDG PET/CT

• Therapeutic Development Potential:

  • MC1R-targeted radionuclide therapy building on successful imaging approaches

  • Recombinant MC1R proteins as tools for developing and validating targeted therapeutics

  • Investigation of differential treatment responses based on MC1R variant status

The development of MC1R-targeted imaging represents an important step toward MC1R-targeted alpha particle therapy, with early clinical trials demonstrating the ability to identify MC1R-positive tumors through image-based methods . This technology creates a foundation for personalized treatment approaches leveraging MC1R expression in melanoma.

How do MC1R variants influence melanoma biology beyond pigmentation effects?

MC1R exerts significant effects on melanoma biology beyond its well-established role in pigmentation:

• Independent Risk Contribution:

  • Statistical evidence shows MC1R variants contribute to melanoma risk through both pigmentation-dependent and independent pathways

  • Risk prediction models demonstrate added value of MC1R genotyping beyond phenotypic characteristics alone

• Variant-Specific Biological Effects:

  • Different classes of variants (R vs. r alleles) show distinct associations with melanoma risk and potentially with survival outcomes

  • Compound genotypes (R/R, R/r, R/w, r/r, r/w, w/w) demonstrate variable effects on disease risk and progression

• Gender-Specific Considerations:

  • Evidence suggests possible worse prognosis among men with certain MC1R variants

  • Gender-specific effects highlight the complex interaction between MC1R and other biological factors

• Therapeutic Relevance:

  • MC1R expression in melanoma tumors can be leveraged for targeted imaging and potential therapeutic applications

  • Variation in expression may influence response to both targeted and conventional therapies

Understanding these non-pigmentation effects of MC1R is essential for fully realizing its potential in melanoma risk assessment, prognosis prediction, and therapeutic targeting. Current research indicates that while MC1R effects on disease course are not consistently strong, they represent an important component of melanoma biology that warrants continued investigation .

What emerging applications of recombinant MC1R proteins show the most promise for melanoma research?

Recombinant MC1R proteins, particularly from well-characterized sources like Erythrocebus patas, offer multiple promising applications for advancing melanoma research:

• Therapeutic Target Validation:

  • High-purity recombinant MC1R (>90%) enables precise characterization of receptor-ligand interactions

  • Structure-activity relationship studies using the full-length 317 amino acid protein to identify optimal binding regions

  • Development of MC1R-targeted therapeutics with higher specificity and reduced off-target effects

• Diagnostic Tools Development:

  • Creation of antibodies against specific MC1R epitopes for improved immunohistochemistry protocols

  • Validation of MC1R-targeted imaging agents through in vitro binding studies

  • Standardization of MC1R detection methods for clinical applications

• Structural Biology Advances:

  • Detailed mapping of the seven transmembrane domains characteristic of this G-protein-coupled receptor

  • Comparative analysis between wild-type MC1R and variant forms to understand functional differences

  • Insights into ligand binding mechanisms and signaling activation

The availability of well-characterized recombinant MC1R proteins provides critical research tools that bridge basic science and translational applications, particularly in developing targeted approaches for melanoma detection and treatment .

How might genome editing of MC1R inform precision medicine approaches in melanoma?

Genome editing technologies applied to MC1R research have significant implications for precision medicine in melanoma:

• Variant Functional Characterization:

  • CRISPR/Cas9-mediated generation of specific MC1R variants to determine their functional consequences

  • Creation of isogenic cell lines differing only in MC1R status to isolate variant-specific effects

  • Comparison of multiple variants to establish hierarchies of functional impact

• Therapeutic Target Validation:

  • Knockout models to confirm MC1R as an essential mediator in melanoma biology

  • Identification of synthetic lethal interactions with MC1R variants that could be therapeutically exploited

  • Validation of downstream pathway dependencies through targeted genomic manipulation

• Personalized Risk Assessment:

  • Development of functional assays based on genome editing findings to better classify MC1R variants

  • Integration of functional data into more sophisticated risk prediction algorithms

  • Identification of high-risk variant combinations for enhanced surveillance strategies

Genome-specific manipulation technologies such as those used to generate MC1R-knockout rabbits demonstrate the power of these approaches for understanding gene function and providing insight into coat color mechanisms . Similar approaches applied to human cellular models could significantly advance personalized medicine approaches for melanoma patients with various MC1R genotypes.

What interdisciplinary approaches could accelerate MC1R-focused melanoma research?

Advancing MC1R research in melanoma requires innovative interdisciplinary strategies:

• Integrated Multi-omics Approaches:

  • Combined analysis of genomic, transcriptomic, and proteomic data to map MC1R pathway effects

  • Correlation of MC1R variant status with comprehensive molecular profiles of melanoma tumors

  • Systems biology modeling of MC1R signaling networks and their perturbation in disease states

• Translational Research Pipelines:

  • Coordinated development of MC1R-targeted imaging and therapeutic approaches

  • Clinical correlation studies linking MC1R genotype to treatment outcomes and survival

  • Biobanking initiatives with comprehensive MC1R genotyping and phenotypic characterization

• Comparative Biology Insights:

  • Analysis of MC1R function across species, from Erythrocebus patas to humans

  • Evolutionary studies of MC1R variation and its relationship to environmental adaptation

  • Cross-species validation of functional effects observed in model organisms

• Machine Learning Applications:

  • Development of improved prediction models incorporating MC1R alongside clinical factors

  • Pattern recognition in complex datasets to identify novel MC1R-associated phenotypes

  • Drug discovery algorithms targeting MC1R-specific vulnerabilities

The integration of these diverse approaches can accelerate progress in understanding MC1R biology and translating these insights into clinical applications. Collaborative research spanning molecular biology, genetics, clinical oncology, and computational science represents the most promising path forward for leveraging MC1R in melanoma management.