Recombinant Escherichia coli 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function

UbiA catalyzes the condensation of 4-hydroxybenzoate (4-HB) with octaprenyl pyrophosphate (OPP) to form 3-octaprenyl-4-hydroxybenzoate, a key intermediate in ubiquinone-8 biosynthesis .

  • Reaction Specificity: Regioselectively prenylates the meta-position of 4-HB .

  • Substrate Flexibility: Accepts isoprenyl pyrophosphates of varying chain lengths (e.g., geranylpyrophosphate) in vitro, though octaprenyl is physiologically preferred .

  • Kinetic Parameters:

    SubstrateApparent KmK_mNotes
    4-Hydroxybenzoate (4-HB)~0.2 mMpH and Mg²⁺ dependent
    Geranylpyrophosphate~0.1 mMHigher affinity than OPP

Genetic Regulation

  • Gene Localization: The ubiA gene is located at 91.5 min on the E. coli chromosome, adjacent to ubiC (chorismate lyase) .

  • Transcriptional Control:

    • Repressed by glucose via catabolite repression, particularly in arcA mutants (a transcriptional regulator of oxygen-responsive genes) .

    • Under anaerobic conditions, expression is regulated by the Fnr protein, linking UbiA to O₂-independent ubiquinone biosynthesis pathways .

Functional Complementation

  • The E. coli ubiA mutant’s respiratory defect is rescued by the yeast COQ2 gene, confirming functional homology between prokaryotic and eukaryotic prenyltransferases .

  • Heterologous expression of ubiA homologs (e.g., Neisseria UbiM) restores ubiquinone synthesis in ubiA-deficient strains .

Inhibitor Discovery

  • 3,6-Dihydroxy-1,2-benzisoxazole (DHB) targets UbiA, acting as both a competitive inhibitor and a prodrug. DHB is prenylated into a nonfunctional product, disrupting ubiquinone biosynthesis in Gram-negative pathogens .

Applications

  • Metabolic Engineering: Downregulating ubiA in E. coli reduces ubiquinone synthesis, enabling redirection of isoprenoid flux for bioproduction of terpenoids .

  • Antimicrobial Development: DHB’s dual mechanism (inhibition and prodrug activation) highlights UbiA as a target for novel antibiotics .

  • Disease Modeling: Structural studies on UbiA inform therapeutic strategies for mitochondrial disorders linked to coenzyme Q deficiencies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development accordingly.
Synonyms
ubiA; ECSE_4332; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSIVVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis, involving the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the ubiA gene in E. coli and related organisms?

The ubiA gene in E. coli belongs to the broader UBiA gene family, which is found across numerous species. Genomic analysis shows that UBiA genes typically contain several conserved exons and introns, with specific structural characteristics that are maintained across evolutionary lines . The gene structure typically includes untranslated regions (UTRs) and coding sequences that can be visualized through genomic mapping techniques.

When studying ubiA genes across different organisms, it's important to consider:

  • The chromosomal location of the gene

  • The presence of conserved domains within the coding sequence

  • The evolutionary relationships between UBiA family members across species

  • The presence of regulatory elements in promoter regions

Phylogenetic analysis of UBiA family genes across 12 species has revealed distinct evolutionary clustering patterns, suggesting functional conservation despite species divergence . This information is valuable when designing heterologous expression systems or when interpreting experimental results across model organisms.

What are the optimal methods for cloning and expressing recombinant ubiA in E. coli systems?

When cloning ubiA for recombinant expression, researchers should consider:

  • Vector selection: pET-based vectors with T7 promoters provide strong, inducible expression for ubiA. Include a C-terminal His-tag to facilitate purification while minimizing interference with the N-terminal membrane-binding domain.

  • Host strain selection: E. coli BL21(DE3) or C41(DE3) strains are recommended as they are designed for membrane protein expression. C41(DE3) particularly accommodates potentially toxic membrane proteins.

  • Growth and induction conditions:

    • Medium: Terrific Broth (TB) supplemented with appropriate antibiotics

    • Temperature: Initial growth at 37°C to OD600 ~0.6, followed by induction at 18-20°C

    • Inducer: 0.1-0.5 mM IPTG (lower concentrations often yield better folding)

    • Post-induction time: 16-20 hours at reduced temperature

  • Cell lysis approach:

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT

    • Detergent solubilization: 1% n-dodecyl-β-D-maltoside (DDM) or 1% Triton X-100

    • Protease inhibitors: Complete protease inhibitor cocktail

For optimal results, membrane fraction isolation prior to detergent solubilization significantly improves yield and purity of functional ubiA enzyme.

How can expression levels of ubiA be verified in recombinant systems?

Verification of ubiA expression requires multiple complementary approaches:

  • Western blot analysis:

    • Use anti-His antibodies if a His-tag was incorporated

    • Consider generating specific antibodies against ubiA peptides

    • Include appropriate membrane protein controls

    • Perform cellular fractionation to confirm membrane localization

  • Enzymatic activity assays:

    • Measure conversion of 4-hydroxybenzoate to prenylated products

    • Use HPLC or LC-MS to detect and quantify reaction products

    • Compare activity to known standards or wild-type levels

  • qRT-PCR for transcript analysis:

    • Design primers specific to ubiA coding regions

    • Use appropriate reference genes for normalization

    • Quantify expression across different tissues or conditions

The relative expression of UBiA genes can vary significantly across different tissues and developmental stages, as demonstrated in studies of the UBiA family . When analyzing expression data, it's important to use appropriate normalization methods and statistical analyses to account for biological variability.

How can protein-protein interactions of ubiA be comprehensively identified?

For identifying protein-protein interactions involving ubiA, researchers can adapt the UbIA-MS methodology, which has been developed for studying ubiquitin interactions . When applying this to ubiA research:

  • Bait preparation:

    • Express recombinant ubiA with an appropriate tag (His, FLAG, or biotin)

    • Ensure the enzyme remains properly folded and functional

    • Consider crosslinking approaches to capture transient interactions

  • Affinity purification:

    • Use native cell lysates containing endogenous protein complexes

    • Maintain conditions that preserve membrane protein interactions

    • Include appropriate detergents (DDM, LMNG) at concentrations that maintain protein-protein interactions

  • Mass spectrometry analysis:

    • Perform on-bead tryptic digestion

    • Use LC-MS/MS for protein identification

    • Apply label-free quantification or SILAC for comparative studies

  • Data analysis:

    • Use computational tools to identify differentially enriched proteins

    • Apply statistical filters (p-value < 0.05, fold change > 2)

    • Validate key interactions through orthogonal methods

This approach can typically identify dozens to hundreds of potential interactors from cell lysates . The entire workflow from bait preparation to interactor identification can be completed within approximately 5 weeks.

What are the key considerations for studying the enzymatic kinetics of recombinant ubiA?

Studying the enzymatic kinetics of membrane-bound ubiA presents several challenges:

  • Substrate preparation:

    • 4-hydroxybenzoate: Commercially available, prepare fresh solutions

    • Polyprenyl diphosphates: Either purchase commercially or synthesize enzymatically

    • Consider solubility issues with prenyl substrates

  • Reaction conditions optimization:

    ParameterRange to TestNotes
    pH7.0-9.0Optimal typically around 7.5-8.0
    Temperature25-37°CBalance activity with stability
    Mg²⁺ concentration1-10 mMEssential cofactor
    Detergent0.01-0.1%Above CMC but below inhibitory conc.
    Reducing agent1-5 mM DTTMaintains enzyme activity
  • Kinetic measurements:

    • Initial velocity measurements are crucial

    • Use HPLC or LC-MS to quantify product formation

    • Consider radiometric assays with ¹⁴C-labeled substrates

    • Fluorescence-based assays may be developed for high-throughput screening

  • Data analysis:

    • Determine Km and Vmax for both substrates

    • Consider potential substrate inhibition effects

    • Apply appropriate kinetic models (Michaelis-Menten, allosteric, etc.)

    • Account for partitioning effects in detergent systems

When reporting kinetic parameters, it's essential to clearly define the experimental conditions, as membrane protein kinetics can vary significantly depending on the reconstitution environment.

How can structural biology approaches be applied to study ubiA despite its membrane-embedded nature?

Membrane proteins like ubiA present significant challenges for structural studies, but several approaches can be effective:

  • X-ray crystallography:

    • Use detergent screening (DDM, LMNG, UDM) to identify optimal solubilization conditions

    • Apply lipidic cubic phase (LCP) crystallization techniques

    • Consider fusion partners (T4 lysozyme, BRIL) to increase soluble domains

    • Use nanobodies or antibody fragments to stabilize conformations

  • Cryo-electron microscopy:

    • Reconstitute in nanodiscs or amphipols for single-particle analysis

    • Use detergent-solubilized protein with careful grid optimization

    • Apply 3D classification to separate conformational states

    • Consider using substrate analogs to trap specific functional states

  • NMR spectroscopy:

    • Selective isotope labeling (¹⁵N, ¹³C) of specific residues or regions

    • Solid-state NMR for membrane-embedded analysis

    • Solution NMR with detergent-solubilized protein for dynamic studies

    • TROSY-based methods to study larger membrane protein complexes

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations in membrane environments

    • Integrative modeling combining low-resolution experimental data

Recent successes with homologous aromatic prenyltransferases suggest that ubiA structural determination is feasible with current technologies, particularly using lipidic cubic phase crystallization combined with protein engineering approaches.

What methods are most effective for investigating the substrate specificity of ubiA?

To comprehensively investigate ubiA substrate specificity:

  • Substrate analog screening:

    • Systematically modify the aromatic acceptor (benzoate derivatives)

    • Test prenyl donors of varying chain lengths (C5 to C50)

    • Quantify activity using HPLC, LC-MS, or enzymatic coupled assays

  • Structure-guided mutagenesis:

    • Target residues in the predicted binding pocket

    • Create libraries of single and multiple mutations

    • Assess changes in substrate preference and catalytic efficiency

  • Competitive inhibition studies:

    • Use structural analogs as potential inhibitors

    • Determine inhibition constants and mechanisms

    • Develop structure-activity relationships

  • Molecular docking and simulations:

    • Apply computational docking of substrate analogs

    • Calculate binding energies and interactions

    • Validate predictions experimentally through mutagenesis

A systematic approach combining these methods can reveal key determinants of substrate recognition and catalysis. This information is valuable for engineering ubiA variants with altered substrate specificity for biotechnological applications.

How can gene expression analysis techniques be applied to study ubiA regulation in various conditions?

Understanding ubiA regulation requires comprehensive gene expression analysis:

  • Transcriptomic approaches:

    • RNA-seq to measure global changes in gene expression

    • qRT-PCR for targeted analysis of ubiA and related genes

    • 5'-RACE to identify transcription start sites and promoter elements

  • Experimental conditions to investigate:

    • Growth phase-dependent expression

    • Stress responses (oxidative, membrane, nutrient limitation)

    • Growth on different carbon sources

    • Anaerobic vs. aerobic conditions

  • Promoter analysis:

    • Reporter gene fusions (lacZ, GFP) to monitor promoter activity

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

    • Electrophoretic mobility shift assays (EMSA) for protein-DNA interactions

  • Data analysis considerations:

    • Normalize expression data appropriately

    • Consider co-expression with other ubiquinone biosynthesis genes

    • Integrate with metabolomic data when possible

Studies examining UBiA gene expression across different tissues have demonstrated tissue-specific regulation patterns . This approach can be adapted to examine ubiA expression in E. coli under different physiological conditions, providing insights into the regulation of ubiquinone biosynthesis.

What are the cutting-edge approaches for engineering ubiA for improved activity or altered specificity?

Several advanced protein engineering approaches can be applied to ubiA:

Understanding the conserved motifs and domains within the UBiA family provides crucial guidance for these engineering efforts, helping researchers identify regions that can be modified versus those that must be preserved for function.

How can researchers troubleshoot common issues with recombinant ubiA expression and purification?

Common challenges and solutions for working with recombinant ubiA:

  • Low expression levels:

    • Optimize codon usage for E. coli expression

    • Try different promoter systems (T7, trc, ara)

    • Reduce induction temperature to 16-18°C

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Consider fusion tags that enhance stability (MBP, SUMO)

  • Protein aggregation:

    • Optimize detergent type and concentration

    • Include stabilizing additives (glycerol 10-20%, specific lipids)

    • Maintain reducing conditions throughout purification

    • Use gentle mixing methods to avoid protein denaturation

    • Consider on-column refolding protocols

  • Loss of activity during purification:

    • Minimize time between cell lysis and activity testing

    • Include substrate analogs during purification

    • Supplement buffers with specific lipids (E. coli total extract)

    • Avoid freeze-thaw cycles (prepare single-use aliquots)

    • Test activity at each purification step to identify problematic steps

  • Verification strategies:

    • Combine SDS-PAGE, Western blot, and mass spectrometry

    • Confirm membrane localization through fractionation

    • Compare activity with native enzyme preparations

    • Validate structural integrity through circular dichroism

A systematic troubleshooting approach, combined with careful documentation of conditions, significantly increases the chances of successful recombinant ubiA production.

What are best practices for designing experiments to study ubiA in the context of the entire ubiquinone biosynthesis pathway?

To study ubiA within the complete ubiquinone biosynthesis pathway:

  • Genetic approaches:

    • Generate conditional knockouts or knockdowns of ubiA

    • Use CRISPR interference for tunable repression

    • Create reporter strains with fluorescent tags on pathway enzymes

    • Construct operon fusions to study coordinated expression

  • Metabolic flux analysis:

    • Use isotope labeling (¹³C) to trace carbon flow through the pathway

    • Quantify intermediates using LC-MS/MS

    • Develop kinetic models of the entire pathway

    • Identify rate-limiting steps through perturbation analysis

  • Protein complex analysis:

    • Investigate potential multi-enzyme complexes using native PAGE

    • Apply proximity labeling techniques (BioID, APEX)

    • Use fluorescence microscopy to study co-localization

    • Perform pull-down assays with tagged pathway components

  • Integrated data analysis:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Apply systems biology modeling approaches

    • Use machine learning to identify regulatory patterns

    • Validate predictions through targeted experiments

Understanding ubiA in its pathway context provides more physiologically relevant insights than studying the isolated enzyme. The approaches used for UBiA family gene identification and characterization can be adapted to study pathway-level interactions and regulation.

How can advanced mass spectrometry techniques be applied to study ubiA and its products?

Mass spectrometry offers powerful tools for ubiA research:

  • Protein characterization:

    • Top-down proteomics for intact protein analysis

    • Bottom-up proteomics with various proteases for sequence coverage

    • HDX-MS (hydrogen-deuterium exchange) to probe protein dynamics

    • Crosslinking MS to identify intra-protein and protein-protein interactions

  • Enzymatic product analysis:

    • Multiple reaction monitoring (MRM) for targeted quantification

    • High-resolution MS for accurate mass determination

    • Ion mobility separation for isomer distinction

    • MS/MS fragmentation patterns for structural confirmation

  • Specialized MS applications:

    • MALDI-imaging MS to visualize spatial distribution in bacterial colonies

    • Native MS to study intact protein complexes

    • DESI-MS for rapid screening without extensive sample preparation

    • Isotopic labeling strategies for mechanistic studies

  • Data analysis considerations:

    • Develop specific MRM transitions for ubiquinone intermediates

    • Account for ion suppression in complex samples

    • Use internal standards for accurate quantification

    • Apply appropriate statistical methods for comparative studies

The UbIA-MS methodology described for ubiquitin interaction studies demonstrates how mass spectrometry approaches can be adapted for protein interaction analysis, a concept that can be similarly applied to study ubiA interactions with other pathway components.

How is synthetic biology being applied to engineer novel ubiA-based pathways?

Synthetic biology approaches for ubiA engineering include:

  • Pathway engineering strategies:

    • Modular assembly of prenyl transferase pathways

    • Creation of artificial operons with optimized gene arrangements

    • Balancing expression levels through promoter and RBS engineering

    • Compartmentalization using bacterial microcompartments

  • Novel applications:

    • Production of non-native prenylated aromatics

    • Incorporation into artificial metabolic circuits

    • Development of biosensors based on ubiA activity

    • Creation of orthogonal ubiquinone pathways

  • Genetic circuit design:

    • Implementation of feedback regulation

    • Inducible control systems for pathway components

    • Toggle switches for metabolic flux redirection

    • Quorum-sensing linked expression systems

  • Performance metrics:

    MetricMeasurement ApproachTarget Performance
    Product titerHPLC/LC-MS quantification>100 mg/L
    Pathway efficiencyCarbon conversion efficiency>30% theoretical
    Dynamic rangeInduction response curve>100-fold
    Genetic stabilitySerial culture passageStable for >50 generations

Understanding the genomic organization and evolution of UBiA family genes provides valuable insights for designing synthetic biology applications, as it reveals natural design principles that can be leveraged in engineered systems.

What computational approaches are most valuable for modeling ubiA structure and function?

Advanced computational approaches for ubiA research:

  • Structural modeling:

    • Homology modeling using related prenyltransferase structures

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations in explicit membrane environments

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism studies

  • Sequence-based analysis:

    • Coevolutionary analysis to predict structural contacts

    • Machine learning for structure and function prediction

    • Ancestral sequence reconstruction to understand evolutionary trajectories

    • Comparative genomics across diverse bacterial species

  • Systems-level modeling:

    • Kinetic modeling of the ubiquinone biosynthesis pathway

    • Flux balance analysis to predict metabolic impacts

    • Whole-cell modeling incorporating ubiA function

    • Integration with experimental -omics data

  • Software and resources:

    • GROMACS or NAMD for molecular dynamics

    • Rosetta for protein design

    • AlphaFold or RoseTTAFold for structure prediction

    • COPASI for kinetic modeling

The analysis of conserved motifs and domains across the UBiA family provides crucial input for computational modeling, helping to identify functionally important regions that should be accurately represented in structural and functional models.

How can researchers investigate the role of membrane composition on ubiA activity and stability?

The membrane environment critically affects ubiA function:

  • Reconstitution approaches:

    • Liposome reconstitution with defined lipid compositions

    • Nanodiscs with controlled size and lipid content

    • Polymer-based systems (amphipols, SMALPs) for native extraction

    • Giant unilamellar vesicles (GUVs) for single-vesicle studies

  • Membrane parameters to investigate:

    • Lipid headgroup composition (PG, PE, cardiolipin ratios)

    • Acyl chain length and saturation

    • Membrane thickness and hydrophobic matching

    • Presence of specific lipid activators or inhibitors

  • Biophysical characterization:

    • Fluorescence anisotropy to measure membrane fluidity

    • Differential scanning calorimetry for phase transitions

    • Solid-state NMR to probe lipid-protein interactions

    • Atomic force microscopy for membrane organization

  • Functional analysis:

    • Activity assays in different membrane environments

    • Substrate accessibility in various reconstitution systems

    • Protein dynamics using EPR spectroscopy

    • Stability measurements under different membrane conditions

Understanding how membrane composition affects ubiA activity provides insights into the enzyme's regulation in vivo and can guide the design of optimal conditions for in vitro studies and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.