Recombinant Escherichia coli Aerobic respiration control sensor protein ArcB (arcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Aerobic Respiration Control Sensor Protein ArcB

Recombinant Escherichia coli Aerobic Respiration Control Sensor Protein ArcB, encoded by the arcB gene, is a crucial component of the Arc system in bacteria. This system plays a pivotal role in regulating gene expression in response to changes in oxygen availability, thereby facilitating the transition between aerobic respiration and anaerobic metabolism. ArcB acts as a membrane-bound sensor histidine kinase, interacting with the quinone pool in the electron transport chain to sense oxygen levels and modulate the activity of the response regulator ArcA .

Structure and Function of ArcB

ArcB is characterized by its complex structure, featuring multiple signaling domains, including a histidine-containing phosphotransfer (HPt) domain and a receiver domain. It is anchored to the cytoplasmic membrane by two transmembrane segments near its N-terminal end . The protein undergoes autophosphorylation when oxygen levels are low, which is enhanced by metabolites such as pyruvate and acetate. This autophosphorylation initiates a phosphorelay that activates ArcA, leading to the regulation of numerous operons involved in metabolic pathways .

Key Features of ArcB:

  • Protein Length: 778 amino acids.

  • Function: Senses oxygen levels through interaction with the quinone pool.

  • Role: Autophosphorylates under anaerobic conditions to activate ArcA.

  • Species: Escherichia coli (strain K12).

  • Uniprot Number: P0AEC3 .

Mechanism of Action

The mechanism of ArcB involves sensing the redox state of the quinone pool. When reduced quinone levels are high, indicating insufficient oxygen for aerobic respiration, ArcB autophosphorylates. This phosphate group is then transferred to ArcA via a phosphorelay mechanism, activating it to regulate gene expression. Under aerobic conditions, ArcB acts as a phosphatase, removing the phosphate from ArcA, which prevents it from binding to DNA and allows genes involved in aerobic metabolism to be expressed .

Phosphorelay Mechanism:

  1. Autophosphorylation of ArcB: ArcB autophosphorylates at a histidine residue when oxygen levels are low.

  2. Phosphotransfer to ArcA: The phosphate is transferred to ArcA through a series of relay steps.

  3. Activation of ArcA: Phosphorylated ArcA binds to specific DNA sequences to regulate gene expression.

Gene Regulation by the Arc System

The Arc system regulates the expression of approximately 30 operons, influencing various metabolic pathways. It represses genes involved in aerobic respiration, such as cytochrome oxidases and gluconeogenic enzymes, while activating genes necessary for anaerobic metabolism, like pyruvate formate lyase .

Regulated Pathways:

  • Aerobic Respiration: Represses genes for cytochrome o and d oxidases.

  • Anaerobic Metabolism: Activates pyruvate formate lyase and lactic acid fermentation pathways.

  • Gluconeogenesis: Represses enzymes involved in the glyoxylate cycle.

Research Findings and Applications

Recent studies have expanded our understanding of the Arc system's role beyond anaerobic conditions, suggesting it also functions under aerobic conditions when oxygen consumption is impaired . Additionally, the Arc system has been implicated in bacterial responses to antibiotics and envelope stress, highlighting its importance in maintaining cellular homeostasis .

Table: Key Features and Functions of Recombinant ArcB

Feature/FunctionDescription
Protein StructureMembrane-bound sensor kinase with multiple signaling domains.
FunctionSenses oxygen levels through quinone pool interaction.
Role in MetabolismRegulates transition between aerobic and anaerobic metabolism.
SpeciesEscherichia coli (strain K12).
Regulated PathwaysRepresses aerobic respiration genes; activates anaerobic metabolism genes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
arcB; b3210; JW5536; Aerobic respiration control sensor protein ArcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-778
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
arcB
Target Protein Sequence
MKQIRLLAQYYVDLMMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIF FGLLITPWAVYFLSVVVEQLEESRQRLSRLVQKLEEMRERDLSLNVQLKDNIAQLNQEIA VREKAEAELQETFGQLKIEIKEREETQIQLEQQSSFLRSFLDASPDLVFYRNEDKEFSGC NRAMELLTGKSEKQLVHLKPADVYSPEAAAKVIETDEKVFRHNVSLTYEQWLDYPDGRKA CFEIRKVPYYDRVGKRHGLMGFGRDITERKRYQDALERASRDKTTFISTISHELRTPLNG IVGLSRILLDTELTAEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVDFTS FLADLENLSALQAQQKGLRFNLEPTLPLPHQVITDGTRLRQILWNLISNAVKFTQQGQVT VRVRYDEGDMLHFEVEDSGIGIPQDELDKIFAMYYQVKDSHGGKPATGTGIGLAVSRRLA KNMGGDITVTSEQGKGSTFTLTIHAPSVAEEVDDAFDEDDMPLPALNVLLVEDIELNVIV ARSVLEKLGNSVDVAMTGKAALEMFKPGEYDLVLLDIQLPDMTGLDISRELTKRYPREDL PPLVALTANVLKDKQEYLNAGMDDVLSKPLSVPALTAMIKKFWDTQDDEESTVTTEENSK SEALLDIPMLEQYLELVGPKLITDGLAVFEKMMPGYVSVLESNLTAQDKKGIVEEGHKIK GAAGSVGLRHLQQLGQQIQSPDLPAWEDNVGEWIEEMKEEWRHDVEVLKAWVAKATKK
Uniprot No.

Target Background

Function

ArcB is a member of the two-component regulatory system ArcB/ArcA, functioning as a sensor-regulator protein for anaerobic repression of the arc modulon. It activates ArcA through a four-step phosphorelay and can also dephosphorylate ArcA via a reverse phosphorelay involving His-717 and Asp-576.

Gene References Into Functions
  1. ArcAB, as a two-component system (TCS), influences nitric oxide detoxification in E. coli under microaerobic conditions, impacting NO* and O2 oscillations. PMID: 28449226
  2. ArcB's redox potential is approximately -41 mV, with menaquinols essential for its activation during anaerobic growth shifts. PMID: 23645604
  3. Different ArcB segment deletions result in distinct d-glucose catabolic flux distributions, differing from those observed in ΔarcB strains. PMID: 23064346
  4. E. coli ArcB activity is modulated by the menaquinone pool's redox state; the ubiquinone/ubiquinol ratio isn't the sole determinant. PMID: 19933363
  5. The ArcB/ArcA/RssB system participates in σS induction under starvation conditions. PMID: 16291649
  6. Active ArcB induces low-level psp expression independently of pIV and interacts with PspB. PMID: 19682256
  7. Both ArcA and ArcB are crucial for hydrogen peroxide resistance, independently of H2O2 scavenging. PMID: 19715602
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the domain architecture of the ArcB sensor kinase?

ArcB is a tripartite hybrid kinase with a highly organized domain structure that facilitates its sensing and signaling functions. The protein contains a transmembrane domain, followed by a PAS (Per-Arnt-Sim) domain, a primary transmitter (H1) domain, a receiver (D1) domain, and a phosphotransfer (H2) domain. The transmembrane region anchors ArcB to the membrane, while the cytoplasmic domains are responsible for signal transduction through a phosphorelay mechanism. The different modules in the sensor protein are clearly defined with specific amino acid coordinates that determine their boundaries . Functional studies have revealed that the conserved His-292 in the transmitter domain is indispensable as the autophosphorylation site, while the receiver domain contains important Asp-533 and Asp-576 residues that play regulatory roles .

To study ArcB's domain architecture experimentally, researchers typically employ targeted deletion strategies to remove specific domains while maintaining the protein's membrane localization. For example, in studies by Georgellis and colleagues, incremental deletions spanning both catalytic and structural parts of the ArcB sensor were implemented to evaluate their effects on the central carbon metabolism of E. coli .

How does ArcB sense changes in redox conditions?

ArcB employs a sophisticated mechanism to sense cellular redox state and transmit this information to regulate metabolic pathways. The primary redox sensing occurs through interactions with quinones and menaquinones, which are membrane-associated electron carriers. In their oxidized form, these carriers inhibit the autophosphorylation of ArcB, effectively silencing the signaling cascade . More specifically, under aerobic conditions, disulfide bridges form between two ArcB monomers by transferring electrons from Cys-180 and Cys-241 (both within the PAS domain) to quinone acceptors, enabling the dephosphorylation of ArcA .

To experimentally investigate this sensing mechanism, researchers can manipulate the redox environment by altering oxygen availability or by using specific electron transport inhibitors. Monitoring ArcB autophosphorylation status under these conditions provides insights into the protein's redox sensing capabilities. Additionally, measuring the oxidation state of the critical cysteine residues through techniques such as differential alkylation followed by mass spectrometry can reveal the precise molecular events involved in redox sensing.

What is the phosphorelay mechanism in the ArcBA system?

The ArcBA phosphorelay represents a multi-step signal transduction process that translates redox signals into transcriptional regulation. Under microoxic conditions, ArcB undergoes autophosphorylation using ATP as the phosphodonor, initiating the phosphorelay . This process involves all three catalytic domains of ArcB in a sequence of intramolecular phosphate transfers, culminating in the transphosphorylation of ArcA, the cognate response regulator .

Once phosphorylated, ArcA-P acts as a transcriptional regulator that modulates the expression of approximately 135 genes . ArcA-P primarily functions as a negative regulator of genes encoding enzymes involved in aerobic pathways, such as the major dehydrogenase enzymes of the tricarboxylic acid (TCA) cycle and the glyoxylate shunt . Conversely, genes encoding enzymes related to fermentation pathways become activated by ArcA-P under microoxic or anoxic conditions .

To study this phosphorelay experimentally, researchers often use in vitro phosphorylation assays with purified components, site-directed mutagenesis of key phosphorylation sites, and phosphoproteomics approaches to track phosphate flow through the system.

How can researchers generate and validate arcB mutant strains?

Creating well-defined arcB mutants is crucial for studying the protein's function. Researchers typically employ PCR-based gene disruption methods using plasmids like pKD4 as templates for generating FRT-aphA-FRT cassettes . These cassettes can be designed with specific flanking regions that target desired portions of the arcB gene. After transformation and selection with appropriate antibiotics, the antibiotic resistance markers can be eliminated using FLP-mediated recombination with plasmids such as pCP20 .

To validate the correct implementation of mutations, researchers should employ a combination of PCR verification and DNA sequencing. For example, using appropriate primer pairs (such as arcB1-C-F, arcB1-C-R, arcB2-C-F, and arcB2-C-R) can help confirm that the correct deletions were introduced into the arcB locus . Functional validation is also essential and can be performed by assessing the phenotypic traits characteristic of arcB mutations, such as altered patterns of fermentation metabolites under anoxic conditions.

A methodical approach to creating arcB mutants might involve:

  • Design of primers targeting specific domains

  • PCR amplification of antibiotic resistance cassettes with arcB-specific flanking regions

  • Transformation of E. coli and selection of transformants

  • FLP-mediated removal of antibiotic resistance markers

  • PCR verification and sequencing of mutants

  • Functional characterization of mutant phenotypes

What methodologies are effective for analyzing the metabolic impact of ArcB mutations?

Analyzing the metabolic consequences of ArcB mutations requires a multi-faceted approach that integrates several experimental techniques. Researchers typically begin with growth parameter analysis under various conditions (particularly anoxic environments) to establish baseline phenotypic differences . This is followed by comprehensive profiling of fermentation metabolites using techniques such as high-performance liquid chromatography (HPLC) or gas chromatography-mass spectrometry (GC-MS) .

Enzyme activity measurements provide another critical layer of analysis. By assessing the activities of key enzymes at metabolic nodes affected by ArcB regulation (such as the PEP/pyruvate and acetyl-CoA nodes), researchers can establish mechanistic links between ArcB function and metabolic outcomes . These enzymatic assays should be complemented with measurements of important metabolic indicators such as the NADH/NAD+ ratio, which is often elevated in arcB mutant strains .

Gene expression analysis using techniques such as qRT-PCR or RNA-Seq adds a further dimension by revealing how transcriptional patterns are altered in arcB mutants. Finally, integration of these experimental data into in silico stoichiometric models of central catabolic pathways can provide a systems-level understanding of how ArcB influences metabolic flux distributions .

How can the ArcB-quinone interaction be experimentally characterized?

The interaction between ArcB and quinones represents a critical aspect of redox sensing that requires specialized experimental approaches. Researchers can use membrane vesicle preparations enriched in ArcB to study how different quinone species and their redox states affect ArcB autophosphorylation in vitro . By manipulating the quinone pool using specific inhibitors or by supplementing with exogenous quinones, the specificity of these interactions can be determined.

Site-directed mutagenesis of key residues in the PAS domain, particularly Cys-180 and Cys-241, provides a complementary approach for understanding how quinones interact with ArcB . Replacing these cysteine residues with serine or alanine can disrupt disulfide bridge formation, allowing researchers to assess the importance of these residues in quinone-mediated signaling.

Advanced biophysical techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative measurements of binding affinities between purified ArcB fragments and quinone molecules. These approaches, combined with structural studies using X-ray crystallography or cryo-electron microscopy, can generate detailed molecular insights into the ArcB-quinone interaction interface.

How do domain-specific deletions in ArcB affect cellular metabolism?

Domain-specific deletions in ArcB produce distinctive patterns of metabolic flux distribution that differ from both wild-type strains and complete arcB deletion mutants. Research has shown that elimination of different segments in ArcB determines a characteristic distribution of D-glucose catabolic fluxes under anoxic conditions . For example, strains lacking either the H1 domain (ArcB 268-520) or the combined PAS, H1, and D1 domains (ArcB 177-640) show altered metabolism compared to both wild-type and complete arcB deletion strains .

These partial deletion mutants exhibit significant alterations at key metabolic nodes, particularly the phosphoenolpyruvate (PEP)/pyruvate and acetyl-coenzyme A nodes . A notable feature of these mutants is their tendency to favor the formation of reduced fermentation metabolites, such as succinate, D-lactate, and ethanol, to different extents compared to wild-type strains . These phenotypic traits correlate with altered levels of the enzymatic activities operating at these nodes, as well as with elevated NADH/NAD+ ratios .

The table below summarizes key metabolic alterations observed in different arcB mutant strains compared to wild-type E. coli under anoxic conditions:

Metabolic FeatureWild-typeΔarcBΔH1 DomainΔPAS-H1-D1 Domains
Growth rateBaselineReducedIntermediateMost reduced
Acetate productionHighReducedIntermediateLow
Ethanol formationModerateElevatedHighHighest
Succinate levelsLowElevatedIntermediateHigh
D-lactate productionModerateHighVariableElevated
NADH/NAD+ ratioBaselineElevatedModerately elevatedHighly elevated

These differences highlight the distinct regulatory roles of individual ArcB domains and suggest that targeted modifications of this global regulator could be exploited for metabolic engineering purposes .

What is the significance of the conserved His-292 residue in ArcB function?

The conserved His-292 residue located in the transmitter domain of ArcB plays an indispensable role in the protein's function. Mutational analysis has definitively established that this histidine serves as the autophosphorylation site, similar to other homologous sensor proteins . When this residue is altered, the autophosphorylation capacity of ArcB is severely compromised, disrupting the initial step of the phosphorelay cascade.

To experimentally verify the importance of His-292, researchers typically employ site-directed mutagenesis to replace this residue with alanine or another amino acid that cannot be phosphorylated. The consequences of such mutations can be assessed by measuring ArcB autophosphorylation activity in vitro using radiolabeled ATP, or by evaluating the expression of ArcA-regulated genes in vivo. The inability of His-292 mutants to initiate the phosphorelay results in phenotypes similar to complete arcB deletion, emphasizing the critical role of this residue in signal transduction.

Interestingly, unlike some domain-specific deletions that produce intermediate phenotypes, mutations affecting His-292 typically result in complete loss of function, indicating that the autophosphorylation step is an absolute requirement for ArcB signaling that cannot be bypassed or compensated for by alternative mechanisms.

How do mutations in the receiver domain affect ArcB signaling?

The receiver domain of ArcB contains conserved aspartate residues (Asp-533 and Asp-576) that play important regulatory roles in the phosphorelay mechanism . Mutations affecting these residues result in compression of the range of respiratory control, suggesting that the receiver domain has a kinetic regulatory role in ArcB function . Unlike mutations in the transmitter domain that completely abolish ArcB activity, receiver domain mutations produce more nuanced effects on signaling.

Experimental approaches to studying the receiver domain typically involve site-directed mutagenesis of the conserved aspartate residues followed by assessment of phosphotransfer efficiency and ArcA-dependent gene expression. In vitro phosphorylation assays with purified protein components can reveal how receiver domain mutations affect the rates of phosphate transfer through the relay system.

An interesting feature of ArcB is that the defective phenotype of all arcB mutants, including those affecting the receiver domain, can be corrected by the presence of the wild-type gene . This suggests that ArcB functions as an oligomer and that wild-type subunits can complement defective ones within these complexes. This property has important implications for the design and interpretation of experiments involving ArcB mutants, particularly in heterozygous situations where both mutant and wild-type proteins are present.

How does the ArcBA system regulate central carbon metabolism?

The ArcBA system exerts extensive control over central carbon metabolism in E. coli through transcriptional regulation of numerous operons involved in both aerobic and anaerobic metabolism. ArcA~P primarily acts as a negative transcriptional regulator of genes encoding enzymes in aerobic pathways, such as the major dehydrogenase enzymes of the tricarboxylic acid (TCA) cycle and the glyoxylate shunt . Conversely, genes encoding enzymes related to fermentation pathways become activated by ArcA~P under microoxic or anoxic conditions .

Experimentally, the regulatory effects of the ArcBA system on central carbon metabolism can be assessed through a combination of approaches. Metabolic flux analysis using 13C-labeled substrates can quantify how carbon flows through different pathways in wild-type versus arcB mutant strains. This can be complemented with enzyme activity measurements for key metabolic enzymes and transcriptional analyses of relevant genes.

What is the relationship between ArcB and cellular redox homeostasis?

To experimentally investigate this relationship, researchers can measure the NADH/NAD+ ratio in wild-type and arcB mutant strains under various growth conditions. This can be done using enzymatic assays or fluorescence-based methods that distinguish between reduced and oxidized forms of the cofactor. Additionally, measuring the expression and activity of enzymes involved in NADH oxidation (such as alcohol dehydrogenase) can provide insights into how cells compensate for altered redox balance in arcB mutants.

The table below summarizes the impact of different arcB mutations on key indicators of redox homeostasis:

Redox IndicatorWild-typeΔarcBDomain-specific deletions
NADH/NAD+ ratioBaselineElevatedIntermediately elevated
Quinone redox stateMore oxidizedMore reducedVariable
Fermentation product profileBalancedShift to more reduced productsIntermediate shifts
Expression of NADH-oxidizing enzymesNormalUpregulatedVariably upregulated

These differences in redox indicators demonstrate that ArcB is a critical component of the cellular machinery for maintaining redox balance under anoxic conditions, and that different structural elements of the protein contribute differentially to this function.

How does ArcB coordinate with other regulatory systems?

ArcB does not function in isolation but rather coordinates with other regulatory systems to fine-tune cellular metabolism in response to environmental conditions. Recent research has shown that ArcB phosphatase activity is regulated not only by quinone redox state but also by fermentation metabolites, adding a further level of complexity to the currently accepted model for ArcBA-mediated transcriptional regulation .

Experimentally investigating these interactions requires systems-level approaches that can capture the complex interplay between multiple regulatory networks. Genome-wide transcriptional profiling can identify genes that are co-regulated by ArcBA and other systems, while genetic approaches involving multiple mutations can reveal functional relationships between different regulators.

For instance, the ArcBA system interacts with the Fnr regulator, another key player in anaerobic gene regulation. While ArcB primarily responds to redox state, Fnr directly senses oxygen. These systems can work both synergistically and antagonistically to control the expression of different sets of genes, creating a sophisticated regulatory network that allows E. coli to adapt to various oxygen availabilities and redox conditions.

How can ArcB be engineered for metabolic engineering applications?

The distinctive metabolic flux distributions observed in arcB mutant strains make them attractive candidates for metabolic engineering applications . By carefully designing mutations in specific domains of ArcB, researchers can potentially redirect carbon flux toward desired fermentation products or optimize cellular redox balance for specific biotechnological processes.

A methodological approach to engineering ArcB for such applications might involve:

  • Creating a library of arcB variants with different domain deletions or point mutations

  • Screening these variants for desired metabolic traits (e.g., enhanced production of specific reduced compounds)

  • Characterizing the best performers in terms of flux distribution, enzyme activities, and redox balance

  • Combining beneficial ArcB modifications with other genetic changes to further optimize the production strain

  • Scale-up and process optimization for the engineered strains

The incremental differences observed in redox homeostasis and central carbon fluxes among different arcB mutant strains provide a versatile toolbox for fine-tuning metabolism . For example, strains with deletions in the PAS-H1-D1 domains show enhanced production of reduced fermentation products like ethanol and succinate, making them potentially useful for biofuel or organic acid production .

What are the current limitations in our understanding of ArcB function?

Despite extensive research, several aspects of ArcB function remain incompletely understood. One significant gap concerns the precise molecular mechanisms by which ArcB senses changes in redox state. While the involvement of quinones and specific cysteine residues has been established, the structural details of these interactions and how they trigger conformational changes in ArcB remain to be fully elucidated.

Another area requiring further investigation is the in vivo effects of different arcB mutations on the central metabolic pathways of E. coli under various growth conditions . Most studies have focused on anoxic conditions, but the role of ArcB in microoxic environments and during transitions between different oxygen availabilities is less well characterized.

The recently discovered regulation of ArcB phosphatase activity by fermentation metabolites adds another layer of complexity that is not yet fully integrated into our understanding of ArcB function . The molecular details of how these metabolites interact with ArcB and how this regulation interfaces with quinone-mediated sensing remain to be determined.

Addressing these limitations will require a combination of structural biology approaches, in vivo metabolic studies, and systems-level analyses that can capture the dynamic and complex nature of ArcB regulation in different environments.

What emerging technologies are advancing ArcB research?

Several cutting-edge technologies are driving new insights into ArcB function and applications:

  • CRISPR-Cas9 genome editing: This technology enables precise and efficient creation of arcB variants with specific mutations or domain deletions, facilitating more comprehensive structure-function studies.

  • Cryo-electron microscopy: Advances in this technique are making it possible to determine the structures of membrane proteins like ArcB in different conformational states, potentially revealing the molecular details of signal sensing and transduction.

  • Metabolic flux analysis using multi-omics approaches: Integration of transcriptomics, proteomics, and metabolomics data with 13C-based flux measurements provides a more comprehensive view of how ArcB influences cellular metabolism.

  • Biosensors for redox state and metabolite concentrations: Development of genetically encoded biosensors for quinone redox state, NAD+/NADH ratio, and key metabolites allows real-time monitoring of the signals that ArcB responds to in living cells.

  • Systems biology modeling: Advanced computational models that integrate multiple levels of regulation (from signal sensing to metabolic outcomes) are helping to predict how different arcB mutations will affect cellular phenotypes under various conditions.

These technologies are not only advancing our fundamental understanding of ArcB function but also enabling more sophisticated engineering of this system for biotechnological applications. As these approaches continue to evolve, they promise to address many of the current knowledge gaps and open new avenues for exploiting ArcB regulation in metabolic engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.