Recombinant Escherichia coli Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism

Lnt catalyzes a two-step reaction:

  1. Acyl-Enzyme Intermediate Formation:

    • The sn-1 acyl chain of phosphatidylethanolamine is transferred to C387, forming a thioester bond .

    • E267 enhances C387 nucleophilicity, while K335 stabilizes the transition state .

  2. N-Acylation of Apolipoproteins:

    • The acyl group is transferred to the α-amino group of the apolipoprotein’s N-terminal cysteine .

    • Residues W237, Y388, and E389 mediate substrate binding and acyl transfer .

Mutagenesis studies confirm that substitutions like C387A/S abolish activity, while E343 and E389 mutants disrupt substrate engagement .

Functional Essentiality and Physiological Roles

Lnt is indispensable for E. coli survival and virulence:

  • Viability: Depletion of Lnt in uropathogenic E. coli CFT073 causes cell lysis, periplasmic swelling, and increased outer membrane permeability .

  • Virulence: Lnt-deficient strains fail to colonize murine liver and spleen, underscoring its role in infection .

  • Lipoprotein Maturation: All E. coli lipoproteins (e.g., Braun’s lipoprotein Lpp) require Lnt-mediated triacylation for proper membrane localization .

Applications and Research Tools

Recombinant Lnt has been utilized to:

  • Study Lipoprotein Biosynthesis: Complementation assays with conditional lnt mutants validate enzyme activity .

  • Drug Discovery: As a target for novel antibiotics due to its essential role in Gram-negative pathogens .

  • Biochemical Assays: In vitro acyltransferase activity is confirmed via mass spectrometry and gel-shift analyses .

Key Research Findings

ParameterWild-Type LntC387S Mutant
Catalytic ActivityFull triacylation of apolipoproteins Acyl-enzyme intermediate trapped
ThermostabilityStable at 37°C Similar stability, no activity
Substrate SpecificityPrefers phosphatidylethanolamine Binds lipids but cannot transfer acyl

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are default shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; cutE; b0657; JW0654; Apolipoprotein N-acyltransferase; ALP N-acyltransferase; Copper homeostasis protein CutE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-512
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
lnt
Target Protein Sequence
MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQALTFNRRPLQSAAIG FCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLYTGLFAGVLSRLWPKTT WLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGLAPIMGVEAINFLLMMVS GLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLKWDEG QLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFLKALDGELRDKGSSLVTGIV DARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVPFGEFVPLESILRPLAPFFDL PMSSFSRGPYIQPPLSANGIELTAAICYEIILGEQVRDNFRPDTDYLLTISNDAWFGKSI GPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEIQAMIPQFTREVLTTNVTPTTGL TPYARTGNWPLWVLTALFGFAAVLMSLRQRRK
Uniprot No.

Target Background

Function
Apolipoprotein N-acyltransferase (Lnt) catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation. This process utilizes a two-step reaction via a ping-pong mechanism. Lnt undergoes covalent modification in the presence of phospholipids, resulting in a thioester acyl-enzyme intermediate. Subsequently, it transfers the acyl chain to the amine group of the N-terminal diacylglyceryl-modified cysteine of apolipoprotein, leading to the formation of mature triacylated lipoprotein. In vitro, Lnt can utilize various phospholipids as acyl donors, including phosphatidylethanolamine (PE), phosphatidylglycerol (PG), phosphatidic acid (PA), and cardiolipin (CL). PE is the most efficient acyl donor.
Gene References Into Functions
  1. High-resolution crystal structures were obtained for membrane-integral Lnt. Thermal stability was measured by circular dichroism. The detergent-solubilized form exhibited N-acylation activity. PMID: 29573991
  2. Data suggests that amino acids located on flexible cytoplasmic and periplasmic loops, predicted to be membrane embedded, are essential for efficient N-acylation of lipoproteins. PMID: 25471278
  3. Lnt is an essential protein in E. coli, and its lethality is partially attributed to the retention of apoLpp in the plasma membrane. PMID: 15513925
  4. Essential residues in Lnt were identified through site-directed mutagenesis and complementation assays. Besides the catalytic triad E267-K335-C387, 4 residues directly affecting the modification of Braun's lipoprotein Lpp are required for Lnt function. PMID: 17416655
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia coli Apolipoprotein N-acyltransferase (Lnt) and what role does it play in bacterial physiology?

Escherichia coli Apolipoprotein N-acyltransferase (Lnt) is an essential enzyme that catalyzes the third step in the bacterial lipoprotein modification pathway. It transfers an acyl group from a phospholipid, typically phosphatidylethanolamine (PtdEtn) in vivo, to the α-amino group of the N-terminal cysteine residue of apolipoproteins, resulting in fully mature triacylated lipoproteins. This N-acylation is crucial for proper lipoprotein trafficking and localization, particularly for those destined for the outer membrane. Lnt's function is essential for E. coli viability because it enables the recognition of outer membrane lipoproteins by the Lol system, which facilitates their transport from the inner to the outer membrane .

What is the structural organization of E. coli Lnt and how does it relate to its function?

The 2.6-Å crystal structure of E. coli Lnt reveals that the enzyme consists of two primary domains:

  • A transmembrane (TM) domain containing eight TM helices that form a membrane-embedded cavity with both a lateral opening to the lipid bilayer and a periplasmic exit.

  • An exo-membrane nitrilase domain located on the periplasmic side of the membrane.

These domains are arranged so that the catalytic cavity of the nitrilase domain connects to the periplasmic exit of the TM domain. Additionally, an amphipathic lid loop from the nitrilase domain interacts with the periplasmic lipid leaflet, forming an interfacial entrance from the lipid bilayer to the catalytic center. This structural arrangement facilitates access of both lipid donor and apolipoprotein acceptor substrates to the enzyme's active site .

What is known about the catalytic site of Lnt and the residues essential for its activity?

The catalytic mechanism of Lnt revolves around a catalytic triad consisting of E267-K335-C387, located in the periplasmic nitrilase domain. Site-directed mutagenesis studies have identified several additional residues as essential for Lnt activity, including W237, E343, Y388, and E389.

Functional analysis of these residues has revealed their specific roles:

  • E267 and E343 are crucial for thio-acylation of C387, as mutations in these residues prevent formation of the acyl-enzyme intermediate

  • K335 appears to stabilize tetrahedral intermediates formed during both steps of the reaction

  • W237, Y388, and E389 are required for the N-acylation of apolipoprotein substrates but do not affect formation of the acyl-enzyme intermediate

The thiol group of C387 serves as the nucleophile that attacks the carbonyl group of the sn-1-glycerolphospholipid, forming the thioester acyl-enzyme intermediate that is subsequently resolved by the apolipoprotein α-amino group .

What is the detailed catalytic mechanism of Lnt?

The catalytic mechanism of Lnt proceeds in two main steps:

  • Formation of acyl-enzyme intermediate: The activated thiol of C387 performs a nucleophilic attack on the sn-1-glycerolphospholipid carbonyl group, generating a lysophospholipid byproduct and a thioester acyl-enzyme intermediate.

  • Resolution by apolipoprotein: The α-amino group of the N-terminal cysteine of the apolipoprotein attacks the thioester bond, resulting in transfer of the acyl group to the apolipoprotein and regeneration of the free enzyme.

This mechanism is analogous to reactions described for members of the nitrilase superfamily, to which Lnt belongs by virtue of the similarity of its periplasmic domain. Biochemical evidence supports this model, showing that in vivo, most Lnt molecules exist as the C387-acyl-enzyme intermediate, demonstrating that the formation of this intermediate is faster than its resolution by apolipoprotein substrates .

How can the acyl-enzyme intermediate of Lnt be experimentally detected?

The acyl-enzyme intermediate of Lnt can be detected using an alkylation approach with maleimide-PEG (malPEG). This technique distinguishes the thioester-linked acyl group at C387 from the free thiol form through the following protocol:

  • Cell membrane preparations containing Lnt are treated with or without hydroxylamine (HA), which specifically cleaves thioester bonds without affecting other protein structures.

  • Samples are then treated with malPEG, which selectively alkylates free thiol groups, resulting in a detectable molecular weight shift.

  • In native Lnt, C387 exists predominantly in the acylated form and shows minimal malPEG modification unless pre-treated with HA.

  • Mutations affecting the first step of catalysis (E267A and E343A) show malPEG modification even without HA treatment, indicating defective thio-acylation.

This experimental approach has been instrumental in identifying residues involved in acyl-enzyme formation versus those required for the N-acylation step .

What methods are used to assess Lnt activity in vitro and in vivo?

Several complementary approaches are used to assess Lnt activity:

In vivo assays:

  • Complementation studies: Testing the ability of mutant Lnt variants to restore viability in conditional lnt mutants.

  • Lipoprotein processing analysis: Monitoring the maturation state of model lipoproteins like Lpp using gel shift assays.

  • MalPEG alkylation: Detecting the acylation state of C387 as described previously.

  • Subcellular fractionation: Analyzing the distribution of lipoproteins between inner and outer membranes to assess Lol-dependent trafficking.

In vitro assays:

  • Purified enzyme assays: Using purified Lnt, phospholipid donors, and apolipoprotein acceptors to measure transfer of radiolabeled or fluorescent acyl groups.

  • Mass spectrometry: Identifying the acylation state of lipoproteins and determining the precise sites of modification.

What expression systems and purification strategies are most effective for producing recombinant Lnt for structural and biochemical studies?

For successful production of recombinant Lnt, the following strategies have proven effective:

Expression systems:

  • E. coli BL21(DE3) or C43(DE3) strains are commonly used for overexpression of membrane proteins like Lnt.

  • Expression vectors incorporating a C-terminal affinity tag (His6 or c-Myc) facilitate detection and purification without affecting activity.

Purification approach:

  • Membrane isolation by ultracentrifugation after cell disruption.

  • Solubilization of membrane proteins using mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or n-decyl-β-D-maltoside (DM).

  • Affinity chromatography using Ni-NTA resin for His-tagged constructs.

  • Size exclusion chromatography for further purification and detergent exchange.

For crystallography studies specifically, incorporation of Lnt into lipidic cubic phase (LCP) has been successful for obtaining well-diffracting crystals, as evidenced by the determination of the 2.6-Å structure .

How do mutations in the catalytic residues of Lnt affect the two-step catalytic mechanism differentially?

Site-directed mutagenesis studies of Lnt's catalytic residues have revealed distinct roles in the two-step reaction mechanism:

MutationEffect on Acyl-Enzyme FormationEffect on N-AcylationEvidence
E267ASeverely impairedNot testable due to first step failureMalPEG modification without HA treatment
E343ASeverely impairedNot testable due to first step failureMalPEG modification without HA treatment
K335APartially impairedPartially impairedPartial malPEG modification without HA
W237AMinimal effectSeverely impairedNo/slight malPEG modification without HA
Y388ANo effectSeverely impairedNo malPEG modification without HA
E389ANo effectSeverely impairedNo malPEG modification without HA

These findings indicate that E267 and E343 are essential for the first catalytic step (acyl-enzyme formation), while W237, Y388, and E389 are specifically required for the second step (N-acylation of apolipoproteins). K335 appears to play a role in both steps, possibly by stabilizing tetrahedral intermediates formed during the reaction .

How does the substrate specificity of Lnt compare between different bacterial species, and what are the implications for antibiotic development?

Lnt exhibits interesting patterns of substrate specificity across bacterial species:

  • Phospholipid donor preference: While E. coli Lnt can use various phospholipids as acyl donors, phosphatidylethanolamine is preferred in vivo. This preference may vary between bacterial species depending on membrane composition.

  • Apolipoprotein recognition: The enzyme recognizes the N-terminal cysteine residue and surrounding sequence of diacylated apolipoproteins, with the lipobox motif (L(A/V)−4-L−3-A(S)−2-G(A)−1-C+1) being crucial for substrate recognition.

  • Evolutionary conservation: Lnt homologs are distributed across diverse bacterial families, including Enterobacteriaceae, Rhizobiaceae, Brucellaceae, Rhodospirillaceae, Rickettsiaceae, Pseudomonadaceae, and Bacteroidaceae, suggesting conserved functional importance.

The essentiality of Lnt in Gram-negative bacteria and its absence in humans makes it an attractive target for antibiotic development. Inhibitors targeting the unique catalytic mechanism or substrate-binding pocket of Lnt could potentially disrupt outer membrane biogenesis, compromising bacterial cell viability and virulence .

How does Lnt compare with the virulence-associated AatD N-acyltransferase family?

Lnt and AatD represent two distinct evolutionary lineages of bacterial N-acyltransferases with important differences:

FeatureLntAatD
DistributionWidely distributed across >20 bacterial familiesRestricted to pathogens of the order Enterobacterales
FunctionEssential for cellular viabilityAssociated with virulence
Genetic locationChromosomalOften plasmid-encoded (EAEC, ETEC) or chromosomal (C. rodentium)
Substrate specificityBroad range of apolipoproteinsSpecific virulence factors (e.g., Aap in EAEC)
Structural similarityServes as structural template for AatDShares core structure with Lnt (94% of AatD sequence matches Lnt with 99.2% confidence)
RegulationConstitutive expressionTightly regulated by AraC/XylS regulators (AggR/Aar)

Despite these differences, the functional mechanism appears conserved, as trans-complementation studies show that Lnt can substitute for AatD in the processing of Aap in EAEC. This suggests a common catalytic mechanism despite divergent biological roles .

What insights can be gained from studying AatD for understanding the evolution and functional diversification of N-acyltransferases?

The identification of AatD as a virulence-associated N-acyltransferase provides several insights into the evolution and functional diversification of this enzyme family:

  • Functional specialization: While Lnt evolved as an essential enzyme for general lipoprotein processing, AatD represents specialization for virulence-specific functions, demonstrating how enzyme functions can be repurposed during evolution.

  • Horizontal gene transfer: The presence of AatD on virulence plasmids in EAEC and ETEC suggests it was acquired through horizontal gene transfer, potentially explaining its restricted distribution among pathogenic Enterobacterales.

  • Regulatory integration: AatD has been integrated into virulence regulatory networks, being controlled by the AggR/Aar duo that regulates numerous other virulence factors, pointing to coordinated evolution of virulence mechanisms.

  • Structural conservation with functional divergence: Despite substantial structural similarity to Lnt, AatD has evolved distinct substrate specificity for virulence factors like Aap, demonstrating how subtle changes in protein structure can drive functional specialization.

These observations suggest that studying horizontally acquired virulence factors like AatD can provide insights into how essential cellular enzymes can be repurposed through evolution to serve pathogen-specific functions .

What are the current challenges in developing selective inhibitors of Lnt as potential antibiotics?

Developing selective inhibitors of Lnt as potential antibiotics faces several challenges:

  • Membrane localization: Lnt's transmembrane domain and active site accessibility complicate inhibitor design and delivery across the bacterial membrane.

  • Selectivity issues: The nitrilase-like domain of Lnt shares structural features with other enzymes, potentially leading to off-target effects.

  • Species variation: Despite functional conservation, structural variations in Lnt between bacterial species may affect inhibitor binding and efficacy across different pathogens.

  • Resistance mechanisms: Potential compensatory mutations or alternative pathways for lipoprotein processing could emerge under selective pressure.

  • Screening limitations: Traditional high-throughput screening approaches are more challenging for membrane proteins, requiring specialized assay development.

A promising approach involves structure-based drug design targeting the unique aspects of Lnt's catalytic mechanism, specifically the formation of the thioester acyl-enzyme intermediate. Compounds that mimic transition states or that irreversibly modify the catalytic cysteine might be particularly effective .

How might understanding the structural basis of Lnt function lead to innovations in protein engineering and biotechnology?

The structural and functional insights from Lnt research could lead to several biotechnological applications:

  • Engineered lipidation systems: Creating modified Lnt variants with altered substrate specificity could enable site-specific lipidation of recombinant proteins for therapeutic applications or research tools.

  • Membrane protein display technologies: Exploiting the lipoprotein processing pathway for efficient surface display of proteins on bacterial cells, potentially enhancing vaccine development or enzyme immobilization approaches.

  • Biosensor development: Utilizing Lnt's lipid-binding properties to create sensors for membrane dynamics or lipid composition changes.

  • Synthetic biology applications: Incorporating lipidation capabilities into synthetic cells or minimal genomes to enable proper membrane protein localization.

  • Drug delivery systems: Developing lipidated peptides or proteins with enhanced membrane permeability or targeting capabilities based on understanding of natural lipoprotein processing.

The detailed structural understanding of how Lnt accommodates both lipid donors and protein acceptors in its catalytic site provides a blueprint for designing enzymes with novel activities at membrane interfaces .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.