Recombinant Escherichia coli ATP-binding/permease protein CydD (cydD)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

CydD functions as part of the CydDC transporter, which has two primary roles:

  • Thiol Export: Mediates ATP-dependent transport of cysteine and glutathione (GSH) to the periplasm, critical for cytochrome bd oxidase assembly .

  • Heme Regulation: Binds heme b and modulates ATPase activity, suggesting a regulatory role in redox homeostasis .

Key Functional Data:

  • Basal ATPase activity of purified CydDC: ~100 nmol Pi/min/mg .

  • Thiol compounds (e.g., cysteine) stimulate ATPase activity 3-fold; heme further enhances this activity but inhibits it at high concentrations .

  • Loss of CydD abolishes cytochrome bd assembly, confirmed by UV-Vis spectroscopy and oxygen consumption assays .

Complementation Studies

  • Cytochrome Restoration: Recombinant CydDC partially restores cytochrome bd assembly in cydD mutant strains, evidenced by regained heme d absorption at 650 nm .

  • Redox Homeostasis: cydD mutants exhibit defective periplasmic cytochrome c assembly, implicating CydDC in maintaining periplasmic redox balance .

Therapeutic Implications

  • Antibiotic Targets: Cytochrome bd (dependent on CydDC) is a target for antimicrobials like aurachin D, highlighting CydD’s pharmacological relevance .

  • Oxidative Stress: cydD mutants show heightened sensitivity to nitric oxide (NO), suggesting roles in pathogen resilience .

Unresolved Questions and Future Directions

  • Mechanism of Heme Interaction: Whether heme acts as a substrate, cofactor, or allosteric modulator remains debated .

  • Structural Resolution: Full 3D atomic structures of CydDC are needed to elucidate transport mechanics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cydD; htrD; b0887; JW0870; ATP-binding/permease protein CydD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
cydD
Target Protein Sequence
MNKSRQKELTRWLKQQSVISQRWLNISRLLGFVSGILIIAQAWFMARILQHMIMENIPRE ALLLPFTLLVLTFVLRAWVVWLRERVGYHAGQHIRFAIRRQVLDRLQQAGPAWIQGKPAG SWATLVLEQIDDMHDYYARYLPQMALAVSVPLLIVVAIFPSNWAAALILLGTAPLIPLFM ALVGMGAADANRRNFLALARLSGHFLDRLRGMETLRIFGRGEAEIESIRSASEDFRQRTM EVLRLAFLSSGILEFFTSLSIALVAVYFGFSYLGELDFGHYDTGVTLAAGFLALILAPEF FQPLRDLGTFYHAKAQAVGAADSLKTFMETPLAHPQRGEAELASTDPVTIEAEELFITSP EGKTLAGPLNFTLPAGQRAVLVGRSGSGKSSLLNALSGFLSYQGSLRINGIELRDLSPES WRKHLSWVGQNPQLPAATLRDNVLLARPDASEQELQAALDNAWVSEFLPLLPQGVDTPVG DQAARLSVGQAQRVAVARALLNPCSLLLLDEPAASLDAHSEQRVMEALNAASLRQTTLMV THQLEDLADWDVIWVMQDGRIIEQGRYAELSVAGGPFATLLAHRQEEI
Uniprot No.

Target Background

Function
This protein is involved in the cytochrome D branch of aerobic respiration. It appears to be a component of a transport system.
Gene References Into Functions
  1. CydDC is the first prokaryotic GSH transporter, and it exports reductant to the periplasm PMID: 16040611
Database Links
Protein Families
ABC transporter superfamily, Cysteine exporter (TC 3.A.1.129.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.