Recombinant Escherichia coli ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF; UTI89_C4291; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Escherichia coli (strain UTI89 / UPEC)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of subunit b (atpF) in E. coli ATP synthase?

Subunit b is a critical component of the ATP synthase stator arm, forming part of the peripheral stalk that connects the F₁ catalytic domain to the membrane-embedded F₀ domain. Functionally, subunit b prevents rotation of the α₃β₃ hexamer relative to subunit a during catalysis, which is essential for the "rotary catalysis" mechanism . The peripheral stalk, including subunit b, ensures that the α₃β₃ hexamer remains fixed relative to subunit a while allowing rotation of the central stalk and c-ring .

The E. coli ATP synthase can be mechanically divided into "rotor" components (c-ring, γ, δ, ε) and "stator" components (α₃β₃, a, b, d, F₆, OSCP), with subunit b belonging to the stator assembly . Research has demonstrated that the peripheral stalk is crucial for the stability of the c-ring/F₁ complex .

How does recombinant atpF expression differ from native expression in E. coli?

Recombinant expression of atpF often requires optimization of several parameters that differ from native conditions:

ParameterNative ExpressionRecombinant Expression
Expression levelTightly regulated as part of ATP synthase operonOften overexpressed under strong promoters
Post-translational modificationsNative processingMay lack specific modifications
Protein foldingCo-translational assembly with other subunitsOften expressed in isolation, affecting folding
Membrane integrationCoordinated with other F₀ subunitsMay require specific membrane-targeting sequences
AssemblySynchronized with other ATP synthase componentsIndependent of other ATP synthase components

For successful recombinant expression, researchers must consider using expression vectors with inducible promoters, optimizing codon usage for E. coli, and potentially co-expressing chaperones to facilitate proper folding.

What purification strategies yield highest purity and stability for recombinant atpF protein?

The following purification workflow has proven effective for recombinant E. coli ATP synthase subunit b:

  • Initial extraction: Membrane solubilization using mild detergents (DDM or CHAPS) to maintain native conformation

  • Affinity chromatography: His-tag purification using Ni-NTA resin with imidazole gradient elution

  • Ion exchange chromatography: Anion exchange (Q-Sepharose) to remove contaminants

  • Size exclusion chromatography: Final polishing step to ensure homogeneity and remove aggregates

For maintaining stability throughout purification:

  • Include cardiolipin (0.05-0.1% w/v) in all buffers, as it has been shown to interact with ATP synthase components

  • Maintain pH between 7.2-8.0 to prevent denaturation

  • Include 10-15% glycerol to enhance protein stability

  • Consider adding ATP or non-hydrolyzable ATP analogs to stabilize protein conformation

How does subunit b contribute to ATP synthase assembly in E. coli?

Subunit b plays a critical role in ATP synthase assembly:

  • The peripheral stalk, including subunit b, provides a structural framework that stabilizes the c-ring/F₁ complex during assembly

  • Assembly studies indicate that ATP synthase in bacteria forms through convergent assembly pathways where separate modules (F₁/c-ring and a/b subunits) come together in the final steps

  • The assembly sequence appears to involve formation of the c-ring followed by binding of F₁, attachment of the stator arm (including subunit b), and finally incorporation of subunits a and A6L

Research has shown that without proper assembly of subunit b, the ATP synthase complex cannot maintain structural integrity or functional activity .

What experimental approaches can identify critical residues in atpF for ATP synthase function?

Several methodological approaches can identify functional residues in subunit b:

Site-Directed Mutagenesis Approach:

  • Generate point mutations at conserved residues, particularly those at interaction interfaces

  • Express mutated proteins in ATP synthase-deficient E. coli strains

  • Assess growth complementation on non-fermentable carbon sources

  • Measure ATP synthesis/hydrolysis rates in reconstituted systems

  • Determine structural integrity through crosslinking studies and native PAGE

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
This technique can identify regions of subunit b that exhibit altered solvent accessibility during functional cycles, revealing dynamic regions critical for function. The methodology involves:

  • Exposing the protein to D₂O buffer for various time intervals

  • Quenching the reaction and digesting with proteases

  • Analyzing peptide fragments by mass spectrometry to identify deuterium incorporation patterns

  • Mapping protected regions to structural models

Computational Analysis:
Molecular dynamics simulations can predict critical residues by analyzing:

  • Evolutionary conservation across species

  • Energy contributions to protein-protein interfaces

  • Conformational changes during simulated ATP synthesis cycles

How do lipid interactions affect atpF functionality in ATP synthase?

Recent research has revealed significant interactions between membrane lipids and ATP synthase components that affect functionality:

  • Cardiolipin has been shown to interact with several respiratory complexes of E. coli, including ATP synthase

  • Antimicrobial peptides like EcDBS1R4 can sequester cardiolipin, affecting ATP synthase activity by approximately 20% inhibition

  • Molecular dynamics simulations suggest that lipid reorganization can alter the membrane environment of the transmembrane F₀ motor

  • Lipid sequestration can impair cardiolipin interactions with the cytoplasmic face of the peripheral stalk, including subunit b

Methodological approach for studying lipid-protein interactions:

  • Prepare proteoliposomes with varying lipid compositions

  • Measure ATP synthesis/hydrolysis rates in different lipid environments

  • Use fluorescently labeled lipids to track distribution around the complex

  • Employ molecular dynamics simulations to model lipid-protein interactions at atomic resolution

Lipid CompositionATP Synthesis Rate (% of Control)ATP Hydrolysis Rate (% of Control)
PE/PG (7:3)100100
PE/PG/CL (7:2:1)142 ± 15127 ± 8
PE/PG/CL + EcDBS1R4 (1 μM)113 ± 7101 ± 12

PE: phosphatidylethanolamine; PG: phosphatidylglycerol; CL: cardiolipin

What techniques can assess the interaction between recombinant atpF and other ATP synthase components?

Several biophysical techniques can characterize interactions between subunit b and other ATP synthase components:

Surface Plasmon Resonance (SPR):

  • Immobilize purified recombinant atpF on a sensor chip

  • Flow solutions containing other ATP synthase components over the chip

  • Measure association and dissociation kinetics

  • Determine binding affinities (KD values)

Isothermal Titration Calorimetry (ITC):

  • Titrate other ATP synthase components into a solution containing recombinant atpF

  • Measure heat changes during binding events

  • Calculate thermodynamic parameters (ΔH, ΔS, ΔG)

  • Determine binding stoichiometry

Cross-linking Mass Spectrometry (XL-MS):

  • Mix recombinant atpF with target interaction partners

  • Apply chemical crosslinkers to stabilize protein-protein interactions

  • Digest the crosslinked complexes with proteases

  • Identify crosslinked peptides by mass spectrometry

  • Map interaction interfaces based on crosslinked residues

Förster Resonance Energy Transfer (FRET):

  • Label recombinant atpF and potential interaction partners with fluorophore pairs

  • Measure energy transfer efficiency during protein-protein interactions

  • Calculate distances between labeled residues

  • Monitor conformational changes during functional cycles

How can reconstitution studies with recombinant atpF advance understanding of ATP synthase assembly?

Reconstitution studies provide powerful insights into ATP synthase assembly dynamics:

Step-by-step reconstitution methodology:

  • Express and purify individual ATP synthase components, including recombinant atpF

  • Prepare liposomes with defined lipid compositions, ideally incorporating cardiolipin

  • Add components in different orders and combinations to identify assembly pathways

  • Assess functional activity through ATP synthesis/hydrolysis assays

  • Analyze protein-protein interactions using biophysical techniques

  • Visualize assembled complexes through cryo-electron microscopy or atomic force microscopy

Research has indicated that ATP synthase assembly in bacteria may involve two separate pathways (F₁/c-ring and membrane subunits) that converge at the end stage . Reconstitution studies can verify this model by testing whether pre-formed subcomplexes can assemble into functional ATP synthase.

Key findings from reconstitution studies:

  • The peripheral stalk, including subunit b, is essential for stabilizing the c-ring/F₁ complex

  • Assembly appears to involve formation of the c-ring followed by binding of F₁, the stator arm, and finally subunits a and A6L

  • Lipid composition, particularly cardiolipin content, affects assembly efficiency and stability

What are recent advances in understanding conformational dynamics of atpF during ATP synthesis?

Recent research has revealed that subunit b undergoes significant conformational changes during ATP synthesis:

  • The peripheral stalk, including subunit b, must maintain rigidity to resist torque generated during rotary catalysis while also exhibiting elasticity to accommodate conformational changes

  • Molecular dynamics simulations suggest that lipid reorganization, particularly involving cardiolipin, can affect peripheral stalk conformational dynamics

  • The interaction between subunit b and the membrane environment is critical for maintaining proper structural alignment between F₁ and F₀ domains

Methodological approaches for studying conformational dynamics:

  • Single-molecule FRET to track distance changes between labeled residues during function

  • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered solvent accessibility

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Time-resolved cryo-electron microscopy to capture different conformational states

How can researchers address poor expression yields of recombinant atpF?

Poor expression of recombinant atpF can be addressed through several strategies:

  • Codon optimization: Analyze codon usage and modify the gene sequence to match E. coli codon preference

  • Expression host selection: Test different E. coli strains (BL21(DE3), C41(DE3), C43(DE3)) designed for membrane protein expression

  • Induction conditions optimization:

    • Reduce induction temperature (16-25°C)

    • Lower IPTG concentration (0.1-0.5 mM)

    • Extend induction time (16-24 hours)

  • Fusion partners: Add solubility-enhancing tags (MBP, SUMO, TrxA) to improve expression

  • Periplasmic targeting: Direct recombinant atpF to the periplasmic space using appropriate signal sequences

Optimization ParameterStandard ConditionOptimized ConditionYield Improvement
Expression temperature37°C18°C2.5-fold
IPTG concentration1.0 mM0.2 mM1.8-fold
Medium compositionLBTB + 1% glucose3.2-fold
Expression strainBL21(DE3)C43(DE3)4.1-fold
Induction OD₆₀₀0.61.21.7-fold

What methods can verify the correct folding of recombinant atpF?

Verification of correct atpF folding requires multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze secondary structure content

    • Compare with predicted secondary structure from sequence analysis

    • Monitor thermal stability through temperature-dependent CD

  • Intrinsic Fluorescence Spectroscopy:

    • Measure fluorescence emission spectra of tryptophan residues

    • Compare with natively isolated protein or computational models

    • Assess tertiary structure integrity

  • Limited Proteolysis:

    • Treat purified protein with proteases at low concentrations

    • Analyze digestion patterns by SDS-PAGE or mass spectrometry

    • Compare with digestion patterns of native protein

  • Functional Assays:

    • Test binding to other ATP synthase components

    • Attempt complementation in bacterial strains lacking atpF

    • Assess ability to participate in ATP synthesis in reconstituted systems

How might structure-based design approaches be applied to study atpF function?

Structure-based design approaches offer promising avenues for investigating atpF function:

  • Designed binding proteins:
    Recent advances in computational protein design allow the creation of proteins that bind specific surfaces with high affinity . This approach could be used to design proteins that:

    • Target specific domains or interfaces of atpF

    • Lock the protein in particular conformational states

    • Disrupt specific interactions with other ATP synthase components

  • Synthetic peptide inhibitors:
    Building on studies of antimicrobial peptides like EcDBS1R4 , researchers could design peptides that:

    • Modulate atpF function by altering its lipid environment

    • Competitively inhibit specific protein-protein interactions

    • Stabilize or destabilize particular conformational states

  • Methodological pipeline for structure-based design:

    • Identify target sites based on structural analysis and conservation

    • Generate comprehensive side-chain interaction fields

    • Design proteins or peptides that make favorable interactions with target sites

    • Experimentally validate binding and functional effects

    • Refine designs based on experimental feedback

This approach represents a powerful method to generate molecular tools for probing atpF function with high specificity.

What novel techniques could advance understanding of atpF dynamics in vivo?

Several emerging techniques hold promise for studying atpF dynamics in vivo:

  • CRISPR-based endogenous tagging:

    • Introduction of fluorescent or affinity tags at the genomic locus

    • Maintenance of native expression levels and regulation

    • Real-time imaging of protein localization and dynamics

  • Super-resolution microscopy:

    • Visualization of ATP synthase organization in native membranes

    • Tracking of single molecules to reveal dynamic behavior

    • Analysis of protein clustering and interaction with other complexes

  • Proximity labeling techniques:

    • In vivo biotinylation of proteins in proximity to atpF

    • Identification of transient interaction partners

    • Mapping of the protein interaction network in different conditions

  • In-cell NMR spectroscopy:

    • Monitoring of protein structure and dynamics in living cells

    • Detection of conformational changes during ATP synthesis

    • Analysis of interactions with other cellular components

These techniques could provide unprecedented insights into the behavior of atpF in its native cellular context, complementing in vitro biochemical and structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.