Recombinant Escherichia coli Bacteriophage N4 adsorption protein B (nfrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Shipping is standard with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nfrB; b0569; JW0558; Bacteriophage adsorption protein B; Bacteriophage N4 adsorption protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-745
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
nfrB
Target Protein Sequence
MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRIKRKLSVYRRYPRMSY RELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFVGTYPNDPDTQRDVDEV CARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFAGFILHDAEDVISPMELR LFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKDVPVREALAGQVPSAGVGT CFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTEIFVRFPVVDEAKEREQRKF LQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFKTHKWTSSLTLNYFLWRDRKG AISNFVSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSGSAWLMTLLWLNFGLMVNRIVQ RVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQVLQHGDPRRVAWDKTTHDFPSV TGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLRLGGSMLMQGLISAEQLAQALAEQ NGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRLENDELIVGSEDGIDPVSLAALTRK VGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAMLYNAVQHQWLTEQQAGEIWRQYVPHQ FLFAEILTTLGHINRSAINVLLLRHERSSLPLGKFLVTEGVISQETLDRVLTIQRELQVS MQSLLLKAGLNTEQVAQLESENEGE
Uniprot No.

Target Background

Function
Essential for bacteriophage N4 adsorption. It is likely a component of the phage receptor.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Escherichia coli Bacteriophage N4 adsorption protein B (nfrB) and what role does it play in phage infection?

NfrB is one of at least four genes (nfrA, nfrB, nfrC, and nfrD) required for irreversible adsorption of bacteriophage N4 to Escherichia coli. Previous characterization has established that nfrB encodes an inner membrane protein critical for phage adsorption. While nfrA encodes an outer membrane protein and nfrC encodes a cytoplasmic protein, these components work together to facilitate the bacteriophage attachment process at the cell surface .

The phage adsorption system involves a coordinated sequence where the bacteriophage must interact with multiple cellular components spanning from the outer membrane through the periplasmic space to the inner membrane. nfrB's inner membrane localization suggests it plays a crucial role in the later stages of the irreversible adsorption process, potentially facilitating conformational changes necessary for DNA injection.

How does nfrB relate structurally and functionally to the other Nfr proteins in the bacteriophage N4 adsorption system?

The bacteriophage N4 adsorption system consists of at least four proteins that form a trans-envelope complex:

ProteinCellular LocalizationMolecular WeightPrimary Function
NfrAOuter membraneUnknownInitial phage recognition and attachment
NfrBInner membraneUnknownMembrane anchoring and signal transduction
NfrCCytoplasm42 kDaCytoplasmic mediator of adsorption process
NfrDUnknown (mapped to min 52 on E. coli linkage map)UnknownUnknown

The phage adsorption process requires all four components, suggesting a coordinated mechanism that spans the entire cell envelope. While nfrA likely provides the initial contact point for the phage at the outer membrane, nfrB as an inner membrane component presumably helps anchor the complex and possibly facilitates conformational changes necessary for irreversible adsorption .

What are the recommended approaches for cloning and expressing recombinant nfrB?

When designing experiments for nfrB expression, researchers should consider:

What are the critical considerations for experimental design when studying nfrB function?

When designing experiments to study nfrB function, researchers should implement these methodological safeguards to ensure robust and reproducible results:

What are the most common technical challenges when working with recombinant nfrB and how can they be addressed?

As an inner membrane protein, nfrB presents several technical challenges that can be addressed through specialized approaches:

ChallengeSolutionMethodological Details
Low expression levelsOptimize codon usageAdapt codons to E. coli preference while maintaining critical sequence regions
Protein misfoldingUse specialized host strainsC41/C43(DE3) strains or others designed for membrane protein expression
ToxicityEmploy tight expression controlUse tunable promoters and lower growth temperatures (16-25°C)
Difficult purificationDetergent screeningSystematically test multiple detergents (DDM, LDAO, etc.) for optimal solubilization
Lack of function post-purificationLiposome reconstitutionReconstitute purified protein into liposomes to restore native membrane environment

Researchers should implement quality control checkpoints throughout the purification process, including Western blot analysis to confirm protein integrity and functional assays to verify that the recombinant protein maintains phage adsorption activity.

How can researchers validate that recombinant nfrB retains native functionality?

Functional validation of recombinant nfrB is critical for ensuring biological relevance. Consider these approaches:

  • Complementation studies: Transform nfrB deletion mutants with the recombinant nfrB construct and assess restoration of phage adsorption capability.

  • Quantitative adsorption assays: Compare phage binding efficiency between cells expressing recombinant nfrB versus native nfrB.

  • Protein-protein interaction studies: Verify that recombinant nfrB maintains appropriate interactions with other Nfr proteins using techniques such as:

    • Co-immunoprecipitation

    • Bacterial two-hybrid systems

    • Cross-linking followed by mass spectrometry

  • In situ labeling approaches: Adapt methodologies similar to those used in protein adsorption studies to monitor nfrB functionality without disrupting its native environment .

How can structural biology approaches advance our understanding of nfrB?

Advanced structural biology techniques can provide critical insights into nfrB function:

  • Cryo-electron microscopy (cryo-EM): Particularly suited for membrane proteins, cryo-EM can potentially resolve the structure of nfrB in its native membrane environment or as part of the complete Nfr complex. This technique avoids the need for crystallization, which is often challenging for membrane proteins.

  • X-ray crystallography: While challenging for full-length membrane proteins, this approach could be applied to soluble domains of nfrB or to the protein stabilized in detergent micelles or lipidic cubic phases.

  • Nuclear Magnetic Resonance (NMR): Solution or solid-state NMR could provide information about specific domains or the dynamics of nfrB during the adsorption process.

  • Molecular dynamics simulations: Computational approaches can model how nfrB might change conformation during phage adsorption and predict critical functional residues.

  • Cross-linking mass spectrometry: This technique can identify interaction interfaces between nfrB and other components of the adsorption machinery, providing insights into the molecular mechanisms of phage attachment.

These approaches should be applied in a complementary manner to build a comprehensive structural understanding of nfrB function.

What bioinformatic approaches can help predict functional domains within nfrB?

Several computational methods can help identify functional regions within nfrB:

  • Comparative sequence analysis: Alignment of nfrB homologs across different phage-host systems can reveal conserved regions likely crucial for function.

  • Transmembrane topology prediction: Tools such as TMHMM, Phobius, or TOPCONS can predict membrane-spanning regions and their orientation.

  • Protein domain prediction: Search for known domains using databases like Pfam, PROSITE, or InterPro that might indicate functional regions.

  • Structural modeling: Use of tools like AlphaFold2 or RoseTTAFold to predict the three-dimensional structure of nfrB based on sequence information.

  • Coevolutionary analysis: Methods like direct coupling analysis (DCA) can identify residues that appear to coevolve, suggesting functional or structural relationships.

These computational predictions should be validated experimentally through targeted mutagenesis of predicted functional domains.

What statistical approaches are most appropriate for analyzing nfrB-related experimental data?

  • For phage adsorption assays:

    • Use ANOVA with appropriate post-hoc tests for comparing multiple conditions

    • Apply non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) if data doesn't meet normality assumptions

    • Report effect sizes along with p-values to indicate biological significance

    • Use regression analysis for time-course or concentration-dependent studies

  • For protein-protein interaction studies:

    • Implement appropriate controls to distinguish specific from non-specific interactions

    • Quantify interaction strengths using appropriate binding models

    • Consider using Bayesian approaches for complex interaction networks

  • For mutational analyses:

    • Apply multiple comparison corrections when screening numerous mutations

    • Use clustering analyses to identify patterns in mutational effects

    • Consider epistasis analysis for understanding interactions between multiple mutations

  • For reproducibility:

    • Report all experimental conditions in detail

    • Make raw data available where possible

    • Ensure sufficient sample sizes based on power analysis

Researchers should remember that experimental design flaws can lead to misleading statistical results, as highlighted in the literature on scientific reproducibility .

How can researchers effectively integrate nfrB studies with broader phage-host interaction models?

To place nfrB research in a broader biological context:

  • Systems biology approach: Integrate nfrB data with other phage-host interaction components to build comprehensive models of the infection process.

  • Comparative genomics: Analyze nfrB homologs across different phage-host systems to understand evolutionary constraints and functional conservation.

  • Multi-omics integration: Combine proteomics, transcriptomics, and metabolomics data to understand how nfrB functions within the broader cellular context.

  • Network analysis: Map the interactions between nfrB and other cellular components to identify additional factors that might influence phage adsorption.

  • Adaptation of existing databases: Consider using frameworks similar to NCycDB to create specialized databases for phage-host interaction components, enabling more comprehensive analysis of phage adsorption systems.

By contextualizing nfrB within these broader frameworks, researchers can gain insights into its evolutionary significance and potential applications in biotechnology and phage therapy.

What are the most promising future research directions for nfrB studies?

Several key areas represent valuable opportunities for advancing nfrB research:

  • Structural characterization: Determining the three-dimensional structure of nfrB, particularly in complex with other Nfr proteins, would provide fundamental insights into the mechanism of phage adsorption.

  • Dynamic studies: Investigating conformational changes in nfrB during the adsorption process could reveal how the protein transitions between states to facilitate phage attachment.

  • Host range determinants: Examining how variations in nfrB sequence influence bacteriophage host specificity could help predict phage-host compatibility.

  • Engineering applications: Exploring how modifications to nfrB might be used to alter phage host range for applications in phage therapy or biocontrol.

  • Integration with broader phage biology: Understanding how the nfrB-mediated adsorption process is coordinated with subsequent steps in phage infection.

These research directions should incorporate methodological advances from adjacent fields, such as the label-free approaches used to study protein adsorption on nanoparticles .

How might high-throughput approaches advance nfrB research?

Emerging high-throughput technologies offer new opportunities for nfrB research:

  • Deep mutational scanning: Systematically testing thousands of nfrB variants to identify residues critical for function and to map the protein's fitness landscape.

  • Single-cell approaches: Monitoring phage adsorption at the single-cell level to understand heterogeneity in the process and identify factors that influence successful infection.

  • High-throughput structural studies: Using emerging techniques in structural biology to rapidly screen conditions for structural determination or to analyze multiple structural states.

  • Automated phenotyping: Developing high-throughput assays for phage adsorption that would allow rapid screening of genetic or environmental factors affecting nfrB function.

  • Computational predictions with experimental validation: Using machine learning approaches to predict nfrB function based on sequence, followed by targeted experimental validation.

These approaches should be implemented with careful attention to experimental design principles to ensure reproducible and meaningful results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.