Recombinant Escherichia coli Bacteriophage T4 late gene expression-blocking protein (lit)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
lit; b1139; JW1125; Cell death peptidase; Bacteriophage T4 late gene expression-blocking protein; GpLit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
lit
Target Protein Sequence
MRSPICHLFSAINSSPFKIAPEKEQDLKTIVDDKKIIISVVSEPGFNIRVRKNESNNSHE IVLTVASLEYIWAFSNFFWVFTQEYSKSQKNNDEHFDLTGKNRLKKSDELLKWARKNLQT TGCESWPKKCPKPEAYLQGSEDSQVASEIFLCAIAWILHHEISHVVLQHPLVTTAFSTQE EREADSHATKWILGNLYESAPELKKRALGIATAVLCIQSLEVENYFCLQNTHPAAYERIY SNISCYPVGNEELIEALCTVMLQYLFHGKNINVNLDGESFSSILGDLLCDISRLTSN
Uniprot No.

Target Background

Function
This protein interacts with a DNA sequence located approximately one-quarter of the way into the major capsid protein gene 23 of bacteriophage T4. Its expression results in general translation inhibition of this late viral gene.
Gene References Into Functions
  1. Phage-elicited suicide of *E. coli* K-12 by Lit represents a variant of "cofactor-induced activation." PMID: 15501819
Database Links

KEGG: ecj:JW1125

STRING: 316407.1651567

Protein Families
Peptidase U49 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the lit protein and what is its fundamental function?

The lit protein (gplit) is an approximately 34-kilodalton inner membrane protein encoded by Escherichia coli that specifically blocks bacteriophage T4 late gene expression. The lit gene is located within the cryptic DNA element e14, and lit(Con) mutations represent up-promoter mutations in this element. Functionally, the lit protein acts as a defense mechanism against T4 infection by interfering with normal regulation that coordinates protein synthesis and T4 head assembly . This interference occurs specifically when the T4 late genes are expressed, creating a unique temporal control mechanism that allows early viral processes to proceed before blocking late gene expression .

How does the lit protein interact with T4 bacteriophage components?

The lit protein interacts, either directly or indirectly, with a short sequence located approximately one-quarter of the way into the major capsid protein gene of T4. This interaction becomes significant when the late gene expression of the virus is activated . The inhibition mechanism is specifically targeted at late protein synthesis, which begins normally in lit mutant hosts but then progressively decreases over the course of infection . Research suggests that since T4 head assembly is thought to occur on the inner face of the E. coli inner membrane, the lit protein's localization to this membrane allows it to interfere with normal regulatory processes coordinating T4 protein synthesis and head assembly .

What distinguishes T4 early gene expression from late gene expression with respect to lit protein action?

T4 gene expression occurs in a temporally regulated cascade, with early genes expressed immediately upon infection, followed by middle and late genes. Experimental evidence demonstrates that T4 early gene expression is not significantly affected by the lit mutation, whereas there is a dramatic inhibitory effect specifically on T4 late protein synthesis . This selective inhibition creates a distinct molecular profile where early viral processes proceed normally while late processes (particularly those involved in viral assembly and maturation) are blocked, effectively preventing the completion of the viral replication cycle.

What are the standard methods for isolating and characterizing lit mutants?

The isolation of lit mutants begins with screening E. coli for strains deficient in their ability to support T4 bacteriophage late gene expression. The standard methodology involves:

  • Infecting E. coli populations with T4 bacteriophage at permissive temperatures (typically 30°C)

  • Selecting colonies that show resistance to complete T4 lytic infection

  • Confirming the phenotype through repeated infection cycles

  • Genetic mapping to localize the mutation to the lit gene region

  • Sequencing to confirm the mutation in the lit gene

Characterization typically involves pulse-chase experiments with radioactive labels to track protein synthesis at different time points post-infection, coupled with analysis using alkaline sucrose gradient centrifugation to examine DNA synthesis patterns . These approaches allow researchers to precisely determine how lit mutations affect T4 replication cycle progression.

How can one express and purify recombinant lit protein for biochemical studies?

For recombinant lit protein production, an E. coli expression system optimized for membrane proteins is recommended, following these methodological steps:

  • Clone the lit gene into an expression vector with an inducible promoter (T7 or arabinose-inducible systems work well)

  • Engineer a fusion tag (His6 or GST) for purification purposes

  • Transform the construct into an expression host strain (BL21(DE3) or derivatives)

  • Optimize expression conditions (temperature, inducer concentration, duration)

  • Lyse cells using detergent-based methods suitable for membrane proteins

  • Purify using affinity chromatography followed by size exclusion chromatography

Since lit is a membrane protein, special consideration must be given to solubilization and stability. Detergents such as n-dodecyl β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) are effective for maintaining protein structure during purification . For structural studies, incorporation of stabilizing mutations or fusion partners (similar to the T4 lysozyme fusion approach used for other membrane proteins) may enhance stability .

In vivo assays:

  • T4 plaque formation efficiency: Comparing plaque numbers and sizes on wild-type versus lit mutant strains

  • Pulse labeling with radioactive amino acids at different time points post-infection to track protein synthesis patterns

  • Reporter gene fusion assays where T4 late promoters drive expression of measurable reporters (like luciferase or β-galactosidase)

In vitro assays:

  • Cell-free transcription-translation systems supplemented with purified lit protein to observe inhibition of T4 late gene expression

  • Membrane binding assays to study lit protein interaction with bacterial membrane components

  • Pull-down assays to identify protein-protein interactions between lit and T4 components

The most definitive measurement comes from combined approaches that track both T4 DNA synthesis (using alkaline sucrose gradient centrifugation) and protein synthesis (using SDS-PAGE analysis of radiolabeled proteins) to distinguish between effects on replication versus translation .

How does the molecular mechanism of lit-mediated inhibition differ from other phage exclusion systems?

The lit-mediated inhibition represents a specialized phage exclusion mechanism with distinct characteristics compared to other systems:

Exclusion SystemTarget ProcessTemporal ActivationMolecular MechanismHost Impact
lit SystemT4 Late Gene ExpressionAfter early gene expressionInteraction with capsid gene sequence, membrane-associated inhibitionMinimal impact on host physiology
Restriction-ModificationDNA CleavageImmediate upon entryEndonuclease activity at unmodified recognition sitesConstitutive expression
CRISPR-CasTargeted DNA/RNA CleavageEarly during infectionRNA-guided nuclease activityAdaptive memory
Abortive Infection (Abi)Various, often translationVariableOften involves toxin-antitoxin systemsOften causes host cell death

What makes the lit system particularly sophisticated is its temporal specificity—it allows early viral processes to initiate before blocking late gene expression, suggesting a regulatory mechanism that monitors infection progression . Unlike restriction systems that target incoming DNA, lit operates after successful early gene expression, acting as a secondary defense line when primary mechanisms fail .

What is the evolutionary significance of the lit gene being located within a cryptic prophage element?

The location of the lit gene within the cryptic DNA element e14 presents an intriguing evolutionary scenario. Cryptic prophages are remnants of phage genomes that have lost essential genes for complete virus production but retain some functional elements. This arrangement suggests several evolutionary implications:

  • The lit gene likely originated from phage-host genetic exchange events

  • Its retention and maintenance within E. coli suggests it provides a selective advantage

  • The system represents an example of how bacteria can repurpose phage-derived genetic elements for self-protection

From an evolutionary biology perspective, this arrangement exemplifies molecular co-evolution, where interactions between hosts and parasites drive reciprocal adaptive changes. The up-promoter mutations observed in lit(Con) strains further demonstrate the dynamic nature of this evolution, where increased expression enhances protection against T4 infection . This evolutionary background provides important context for researchers investigating similar defensive systems in other host-phage interactions.

How do lit protein interactions with the T4 major capsid protein gene sequence specifically inhibit late gene expression?

The mechanism underlying lit protein's interaction with the T4 major capsid protein gene sequence involves a complex interplay of factors:

  • The lit protein interacts with a specific sequence approximately one-quarter of the way into the major capsid protein gene

  • This interaction appears to trigger a cascade effect that disrupts late gene expression

  • Since the lit protein is an inner membrane protein, and T4 head assembly occurs on the inner face of the inner membrane, the inhibition likely disrupts the spatial organization required for proper assembly

The selectivity for late gene expression is particularly intriguing, as it suggests the lit protein can distinguish between different temporal phases of T4 gene expression. This selectivity may relate to the different mechanisms controlling early versus late gene expression in T4. Late gene expression depends on the T4 gene 55 protein (gp55), which enables E. coli RNA polymerase core to recognize T4 late promoters . One hypothesis is that lit directly or indirectly interferes with gp55 function, though the precise mechanism remains to be fully elucidated.

What are common pitfalls in experimental designs studying lit protein function?

Researchers frequently encounter several challenges when investigating lit protein function:

  • Temperature sensitivity: lit mutant phenotypes are often temperature-dependent, showing stronger effects at 30°C than at 37°C. Experiments conducted at inappropriate temperatures may yield inconsistent results .

  • Genetic background effects: The E. coli strain background can significantly influence lit phenotype expression. Always use isogenic strains for comparative analyses.

  • Temporal sampling issues: Due to the time-dependent nature of lit inhibition, single time-point measurements can be misleading. Design experiments with multiple sampling points post-infection (recommended: 5, 10, 15, 20, and 30 minutes) .

  • Membrane protein purification challenges: As an inner membrane protein, lit can be difficult to purify in its native conformation. Optimization of detergent conditions is crucial for maintaining activity.

  • Phage stock heterogeneity: Natural variations in phage stocks can confound results. Use well-characterized, homogeneous phage stocks, ideally derived from single plaques.

To mitigate these issues, include appropriate controls in every experiment (wild-type strains, temperature controls), use time-course approaches rather than single time points, and carefully validate antibodies or tags used for lit protein detection.

How can conflicting data regarding lit protein mechanisms be reconciled?

Contradictory findings regarding lit protein mechanisms can arise from several sources. A systematic approach to reconciliation includes:

  • Methodological assessment: Compare experimental approaches, particularly strain backgrounds, growth conditions, and assay sensitivities.

  • Context dependence: The lit inhibition may function differently depending on phage concentration (multiplicity of infection), growth phase of bacteria, or medium composition.

  • Phage strain variations: Different T4 strains or mutants may interact differently with the lit system. The T4 Gol mutant, for example, shows altered interactions with lit compared to wild-type T4 .

  • Molecular integration analysis: Consider how lit fits into larger cellular networks, including possible interactions with other host defense systems or stress responses.

  • Direct vs. indirect effects: Distinguish between direct effects of lit and downstream consequences by using time-resolved approaches.

When analyzing conflicting data, create a systematic comparison table outlining key experimental variables and outcomes across different studies. This approach often reveals conditional factors that explain apparent contradictions.

What strategies can enhance the stability and activity of recombinant lit protein for structural studies?

Structural studies of membrane proteins like lit present significant challenges. Several strategies can improve success rates:

  • Fusion protein approaches: Following the successful T4 lysozyme fusion strategy used for other membrane proteins, inserting T4 lysozyme into predicted loop regions of lit protein can enhance stability without compromising function .

  • Detergent screening: Systematic screening of detergents is crucial. A recommended panel includes:

    • n-dodecyl-β-D-maltoside (DDM)

    • lauryl maltose neopentyl glycol (LMNG)

    • n-octyl-β-D-glucoside (OG)

    • digitonin

  • Lipid nanodisc incorporation: Reconstituting lit protein into lipid nanodiscs can provide a more native-like membrane environment for functional and structural studies.

  • Thermostabilizing mutations: Introducing mutations that enhance thermostability (identified through alanine scanning or directed evolution) can significantly improve protein behavior during purification and crystallization.

  • Antibody fragment co-crystallization: Using Fab or nanobody fragments that bind to lit protein can provide additional crystal contacts and stabilize flexible regions.

  • Cryo-EM approaches: For particularly challenging proteins, single-particle cryo-electron microscopy may prove more successful than crystallography, especially when combined with the stabilization strategies mentioned above.

The choice of methodology should be guided by the specific research question, with X-ray crystallography offering higher resolution but requiring stable crystals, while cryo-EM provides more flexibility in sample preparation but potentially lower resolution for smaller proteins like lit.

How might CRISPR-Cas9 technology advance our understanding of lit protein function?

CRISPR-Cas9 technology offers several powerful approaches to investigate lit protein function:

  • Precise genomic editing: Creating clean deletions, point mutations, or tagged versions of the lit gene in its native genomic context allows for studying function without plasmid artifacts.

  • Domain mapping: Systematic introduction of mutations across the lit gene can identify critical functional domains and residues.

  • Regulon identification: CRISPR interference (CRISPRi) or activation (CRISPRa) can be used to modulate expression of potential lit-interacting genes to identify genetic networks.

  • High-throughput screening: CRISPR library screens can identify bacterial genes that influence lit function, revealing potential co-factors or regulators.

  • Temporal control: Inducible CRISPR systems allow for precise temporal control of lit expression, enabling researchers to determine exactly when lit function is required during phage infection.

Additionally, CRISPR-based phage engineering systems, similar to those developed for T4-based artificial viral vectors , could be adapted to create modified phages with altered sensitivity to lit inhibition, providing new insights into the interaction specificities.

What potential applications exist for lit protein in synthetic biology and phage technology?

The unique properties of the lit system present several promising applications:

  • Controlled phage replication systems: Engineering lit-based switches could create phages that undergo limited replication cycles, useful for phage therapy applications where controlled lysis is desirable.

  • Bacterial containment mechanisms: Synthetic lit variants could be designed as biological containment systems for engineered bacteria, triggering growth arrest under specific conditions.

  • Programmable gene expression regulators: Modified lit proteins could potentially be engineered to respond to specific signals and regulate targeted gene expression pathways.

  • Phage resistance engineering: For industrial fermentations where phage contamination is problematic, enhanced lit systems could provide robust phage protection.

  • Phage-based delivery systems: Understanding how lit blocks T4 late gene expression could inform the design of improved T4-based artificial viral vectors for human gene therapy, potentially enhancing their safety profiles .

The application of lit protein mechanisms in the context of T4-based artificial viral vectors is particularly promising, as these vectors are being developed to deliver large DNA cargoes (up to ~171 Kbp) and perform complex molecular operations in human cells .

How might structural comparisons between lit and other phage exclusion proteins reveal convergent defense mechanisms?

Comparative structural biology of phage exclusion proteins represents a frontier in understanding host-phage interactions. Several approaches are particularly promising:

  • Structural motif analysis: Identifying common structural motifs across diverse phage exclusion proteins could reveal convergent functional elements despite limited sequence similarity.

  • Membrane interaction interfaces: Comparing membrane association domains between lit and other membrane-associated defense proteins may reveal common principles of membrane positioning for defense functions.

  • Recognition domain comparison: Structural analysis of how different exclusion proteins recognize phage components could uncover shared recognition principles.

  • Evolutionary trajectory mapping: Structural comparison combined with phylogenetic analysis can reveal how different defense systems evolved similar solutions from different starting points.

  • Allosteric regulation mechanisms: Understanding how recognition of phage components triggers inhibitory activity across different systems could reveal common regulatory principles.

These comparative approaches require solving the structure of lit protein, ideally in complex with its target phage components. While challenging due to lit's membrane protein nature, the fusion protein approach that successfully stabilized other membrane proteins for structural studies could be adapted for lit , potentially using T4 lysozyme as a fusion partner to enhance crystallization properties while maintaining functionality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.