Recombinant Escherichia coli Bactoprenol glucosyl transferase homolog from prophage CPS-53 (yfdH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfdH; b2351; JW2347; Prophage bactoprenol glucosyl transferase homolog; Bactoprenol glucosyl transferase homolog from prophage CPS-53
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yfdH
Target Protein Sequence
MKISLVVPVFNEEEAIPIFYKTVREFEELKSYEVEIVFINDGSKDATESIINALAVSDPL VVPLSFTRNFGKEPALFAGLDHATGDAIIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRLKRKTAEWFYKLHNKISNPKIEENVGDFRLMSRDVVENIKLMPERNLFMKGI LSWVGGKTDIVEYVRAERIAGDTKFNGWKLWNLALEGITSFSTFPLRIWTYIGLVVASVA FIYGAWMILDTIIFGNAVRGYPSLLVSILFLGGIQMIGIGVLGEYIGRTYIETKKRPKYI IKRVKK
Uniprot No.

Target Background

Function

Involved in O antigen modification. This protein catalyzes the transfer of a glucose residue from UDP-glucose to a lipid carrier.

Database Links
Protein Families
Glycosyltransferase 2 family, GtrB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yfdH and what reaction does it catalyze?

yfdH (also known as gtrB) is a bactoprenol glucosyl transferase enzyme found in the CPS-53 (KpLE1) prophage of Escherichia coli K-12 substr. MG1655. It is localized to the inner membrane and catalyzes the following reaction:

UDP-α-D-glucose + di-trans,octa-cis-undecaprenyl phosphate → β-D-Glc-PP-Und + UDP

This transferase activity is crucial for modifying cell surface polysaccharides in bacteria. The enzyme transfers the glucose moiety from UDP-glucose to the lipid carrier bactoprenol (undecaprenyl phosphate), forming a key intermediate in bacterial envelope biogenesis processes.

How is yfdH structurally classified and what are its key domains?

yfdH is classified as an inner membrane protein with a length of 306 amino acids (921 bp). Its accession IDs include G7220 (MetaCyc), b2351, ECK2345, and P77293 (UniProt) . The protein contains membrane-spanning domains typical of glycosyltransferases that function at the cytoplasmic membrane interface.

Methodologically, to analyze the structure-function relationship of yfdH, researchers should consider:

  • Transmembrane domain prediction using algorithms like TMHMM or Phobius

  • Multiple sequence alignment with other glycosyltransferases to identify conserved catalytic residues

  • Homology modeling based on crystallized bacterial glycosyltransferases

  • Site-directed mutagenesis of predicted catalytic residues to confirm their functional importance

What are the optimal conditions for recombinant expression of yfdH in E. coli?

For optimal recombinant expression of yfdH in E. coli, researchers should consider applying Design of Experiments (DoE) methodologies to systematically optimize expression parameters. Based on DoE principles applied to membrane protein expression:

  • Expression vector selection: Consider vectors with tunable promoter strength rather than high-copy vectors with strong constitutive promoters, as membrane protein overexpression can be toxic to cells.

  • Host strain selection: C41(DE3) or C43(DE3) strains are often preferred for membrane protein expression as they are adapted to tolerate membrane protein toxicity.

  • Induction parameters: Critical factors to optimize include:

    • IPTG concentration (typically 0.1-1.0 mM)

    • Induction temperature (lower temperatures of 16-25°C often yield better folding)

    • Induction time (typically 4-16 hours)

  • Media composition: As shown in DoE studies, media components can significantly impact recombinant protein expression. Concentrations of glucose, succinate, and IPTG have been identified as significant factors affecting enzyme activity in E. coli expression systems .

A full factorial DoE approach would allow for systematic testing of these variables to determine optimal expression conditions, though a definitive screening design (DSD) might be more efficient with fewer experimental runs .

What purification strategy yields the highest recovery of active yfdH?

As an inner membrane protein, yfdH requires specialized purification strategies:

  • Membrane fraction isolation:

    • Cell disruption by sonication or French press

    • Differential centrifugation to separate membrane fractions

    • Ultracentrifugation to isolate inner membrane fraction

  • Detergent screening for solubilization:

    • Test a panel of detergents (DDM, LDAO, OG) at various concentrations

    • Monitor protein stability and activity after solubilization

    • Consider implementing a DoE approach to optimize detergent type, concentration, and solubilization time

  • Purification steps:

    • IMAC (Immobilized Metal Affinity Chromatography) if using a His-tagged construct

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

  • Activity preservation:

    • Inclusion of stabilizing agents (glycerol, specific lipids)

    • Optimization of buffer conditions (pH, ionic strength)

    • Consideration of reconstitution into nanodiscs or liposomes for functional studies

For methodological optimization, researchers should monitor both protein yield and enzymatic activity throughout purification to ensure the isolated protein maintains its catalytic function.

How can the enzymatic activity of yfdH be measured in vitro?

Several complementary approaches can be employed to measure yfdH activity:

  • Radiometric assay:

    • Using [14C]- or [3H]-labeled UDP-glucose as substrate

    • Measurement of labeled β-D-Glc-PP-Und product formation

    • Quantification by scintillation counting after organic extraction

  • Coupled enzyme assay:

    • Monitoring UDP release through coupling with pyruvate kinase and lactate dehydrogenase

    • Following NADH oxidation spectrophotometrically at 340 nm

  • HPLC-based methods:

    • Direct quantification of substrate depletion and product formation

    • Requires standards for UDP-glucose and β-D-Glc-PP-Und

  • Mass spectrometry:

    • LC-MS/MS to directly detect and quantify reaction products

    • Particularly useful for confirming product identity

The reaction parameters that should be optimized include:

  • pH (typically 6.5-8.0)

  • Divalent cation concentration (Mg2+ or Mn2+)

  • Detergent concentration

  • Temperature

When comparing different enzyme variants or conditions, initial velocity measurements should be performed to determine kinetic parameters (Km, Vmax, kcat).

What are the kinetic parameters of wild-type yfdH and how do they compare to other glycosyltransferases?

While specific kinetic parameters for yfdH are not provided in the search results, researchers studying this enzyme should establish the following:

  • Basic kinetic parameters:

    • Km for UDP-α-D-glucose (expected range: 10-100 μM)

    • Km for di-trans,octa-cis-undecaprenyl phosphate (expected range: 1-50 μM)

    • kcat (catalytic rate constant)

    • kcat/Km (catalytic efficiency)

  • Methodological approach:

    • Vary one substrate concentration while keeping the other constant

    • Plot reaction velocity versus substrate concentration

    • Fit to Michaelis-Menten equation for parameter determination

    • Consider potential inhibition by high substrate concentrations

  • Comparison metrics:

    • Catalytic efficiency relative to other bacterial glycosyltransferases

    • Substrate specificity profile (testing various UDP-sugars)

    • pH and temperature optima/stability profiles

These parameters provide essential baseline data for comparison with mutant variants and for establishing structure-function relationships.

How can Design of Experiments (DoE) approach improve yfdH expression and activity?

DoE methodologies offer systematic frameworks for optimizing complex biological systems like recombinant protein expression and enzymatic activity:

  • Full factorial designs:

    • Test every possible combination of factors at discretized levels

    • Allows detection of interactions between factors

    • Example: A study using full factorial design identified that succinate, glucose, and IPTG concentrations were significant factors influencing recombinant enzyme activity in E. coli

    • Benefits: Reveals interactions between variables, even in well-characterized systems

    • Limitations: Resource-intensive due to large number of experimental combinations

  • Definitive screening designs (DSDs):

    • More efficient than full factorial designs

    • Can estimate main effects and interactions with fewer experiments

    • Requires only 2N+1 experimental runs for N factors

    • Allows estimation of quadratic effects without confounding with main effects

    • Particularly useful when curvature is anticipated in the response variable

  • Application to yfdH optimization:

    • Factors to consider: promoter strength, RBS strength, induction parameters, media components

    • Response variables: protein yield, specific activity, membrane integration efficiency

    • Implementation of DSDs can achieve significant improvements with minimal experimental burden (e.g., a similar approach yielded two-fold improvement in production of other recombinant enzymes)

Table 1: Example DoE factors for optimizing yfdH expression

FactorTypeLow levelMedium levelHigh level
Promoter strengthContinuous0.1×0.5×1.0×
RBS strengthContinuous0.1×0.5×1.0×
IPTG concentrationContinuous0.1 mM0.5 mM1.0 mM
Induction temperatureContinuous16°C25°C37°C
Media component (glucose)Continuous0.2%0.5%1.0%
Media component (succinate)Continuous0 mM25 mM50 mM

What mutagenesis strategies can elucidate the structure-function relationship of yfdH?

Several complementary mutagenesis approaches can be employed:

  • Alanine scanning mutagenesis:

    • Systematically replace conserved residues with alanine

    • Measure impact on enzymatic activity and substrate binding

    • Identify essential catalytic and binding residues

  • Chimeric protein construction:

    • Create chimeras between yfdH and related glycosyltransferases

    • Map domains responsible for specific aspects of function

    • Identify regions contributing to substrate specificity

  • Targeted evolution approaches:

    • Error-prone PCR to generate diversity

    • Selection for variants with enhanced activity or altered specificity

    • Deep mutational scanning to comprehensively map sequence-function relationships

  • Structure-guided mutagenesis:

    • Based on homology models or structural predictions

    • Target residues in predicted active site or substrate binding pockets

    • Introduce mutations to test specific mechanistic hypotheses

Analysis of mutant libraries should employ high-throughput activity assays and potentially combine with DoE approaches to efficiently explore the sequence-function landscape.

How does yfdH interact with membrane phospholipid transport pathways?

While the search results don't directly link yfdH to phospholipid transport pathways, its location in the inner membrane suggests potential interactions with membrane biology processes:

  • Membrane context:

    • As an inner membrane protein, yfdH functions in the same cellular compartment where phospholipid transport processes occur

    • The glycosylation of lipid carriers may indirectly influence membrane composition and properties

  • Relationship to other membrane processes:

    • Research on other inner membrane proteins like YhdP has demonstrated roles in modulating phospholipid transport rates and maintaining the outer membrane permeability barrier in Gram-negative bacteria

    • yfdH could potentially interact with similar transport systems due to its localization

  • Methodological approaches to investigate interactions:

    • Protein-protein interaction studies (bacterial two-hybrid, co-immunoprecipitation)

    • Lipidomic profiling in yfdH mutants versus wild-type

    • Membrane permeability assays in mutant strains

    • Fluorescently-labeled phospholipid tracking in cells with altered yfdH expression

These approaches would help elucidate whether yfdH plays any direct or indirect role in membrane phospholipid dynamics beyond its characterized enzymatic function.

What is the physiological role of yfdH in E. coli and how does it contribute to cellular envelope properties?

As a prophage-encoded glycosyltransferase, yfdH likely contributes to modifications of cell surface polysaccharides:

  • Potential physiological roles:

    • Modification of lipopolysaccharide (LPS) O-antigen

    • Alteration of cellular surface properties

    • Possible role in phage resistance mechanisms

    • Contribution to biofilm formation or adhesion properties

  • Investigative approaches:

    • Comparison of wild-type and ΔyfdH strains for changes in:

      • LPS profile (analyzed by SDS-PAGE and silver staining)

      • Cell surface hydrophobicity

      • Biofilm formation capacity

      • Resistance to bacteriophage infection

      • Envelope permeability (using dye penetration assays)

  • Connection to membrane integrity:

    • Studies of other membrane proteins have shown that alterations in lipid transport and metabolism can significantly impact outer membrane integrity and permeability

    • Investigation of potential interactions between yfdH and proteins involved in envelope maintenance would be valuable

Methodologically, researchers should combine genetic approaches (gene deletion, complementation) with biochemical and biophysical techniques to comprehensively characterize the physiological impact of yfdH.

How can systems biology approaches be applied to understand the role of yfdH in the context of the bacterial envelope biogenesis network?

Systems biology offers powerful frameworks to contextualize yfdH function:

  • Multi-omics integration:

    • Transcriptomics: RNA-seq comparing wild-type and ΔyfdH strains under various conditions

    • Proteomics: Quantitative proteomics to identify changes in membrane protein abundance

    • Metabolomics: Analysis of changes in cell envelope-related metabolites

    • Lipidomics: Characterization of membrane lipid composition changes

  • Network analysis:

    • Construction of protein-protein interaction networks centered on yfdH

    • Metabolic flux analysis to determine impact on cell envelope precursor metabolism

    • Identification of genetic interactions through synthetic genetic array analysis

  • Mathematical modeling:

    • Kinetic modeling of the enzymatic reaction in the context of cell envelope biogenesis

    • Integration of yfdH activity into whole-cell models of E. coli metabolism

    • Prediction of system-level effects of yfdH perturbation

  • Experimental design considerations:

    • Application of DoE principles to efficiently test combinations of genetic and environmental factors

    • Use of definitive screening designs to identify non-linear effects and interactions with minimal experimental burden

These approaches would place yfdH within its broader biological context and reveal unexpected connections to other cellular processes.

What are the challenges and solutions in crystallizing membrane proteins like yfdH for structural determination?

Crystallizing membrane proteins presents unique challenges:

  • Major challenges:

    • Hydrophobicity and instability outside native membrane environment

    • Conformational heterogeneity

    • Limited crystal contacts due to detergent micelles

    • Low expression yields

  • Modern solutions:

    • Lipidic cubic phase (LCP) crystallization

    • Crystallization in lipidic bicelles

    • Antibody fragment (Fab) mediated crystallization to increase polar surface area

    • Fusion protein approaches (e.g., T4 lysozyme fusion)

    • Nanobody-assisted crystallization

  • Alternative structural approaches:

    • Cryo-electron microscopy (especially for larger complexes)

    • NMR spectroscopy for dynamics studies

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

    • Computational modeling guided by experimental constraints

  • Methodological workflow:

    • Protein engineering to remove flexible regions

    • Systematic detergent screening

    • High-throughput crystallization condition screening

    • Application of DoE principles to optimize crystallization parameters

Researchers should consider a multi-pronged approach, pursuing several structural methods in parallel to maximize chances of success with challenging membrane proteins like yfdH.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.