Recombinant Escherichia coli Bactoprenol-linked glucose translocase homolog from prophage CPS-53 (yfdG)

Shipped with Ice Packs
In Stock

Description

General Information

The yfdG gene product is a membrane protein involved in the translocation of glucose linked to bactoprenol . Bactoprenol serves as a lipid carrier that transports glycosyl moieties across the cell membrane during the synthesis of various cell surface structures, including the O-antigen of lipopolysaccharide . The yfdG protein facilitates the movement of glucose across the cytoplasmic membrane, which is a crucial step in synthesizing these structures .

Role in O-Antigen Modification

O-antigens are polysaccharides that form the outermost part of the lipopolysaccharide (LPS) layer in Gram-negative bacteria like E. coli . These O-antigens contribute to the bacterium's structural integrity and protect against environmental stressors, including the host's immune system . The yfdG protein plays a role in modifying the O-antigen by translocating glucose, a building block for the polysaccharide chain, across the cell membrane .

Regulation of Glucose Transport

The regulation of glucose transport in E. coli is complex, involving catabolite repression (CCR) and inducer exclusion mechanisms . The cAMP-CRP complex, adenylate cyclase (Cya), and the glucose-specific enzyme II (EIICDGlc) play roles in CCR . Additionally, small regulatory RNAs, like SgrS, regulate the abundance of EIICBGlc by influencing the translation of ptsG, which encodes a glucose-specific transporter .

Recombinant Protein Expression in E. coli

Recombinant protein expression in E. coli is a widely used technique in biotechnology . It involves introducing a gene of interest into E. coli and allowing the bacteria to produce the corresponding protein . The production of recombinant E. coli bactoprenol-linked glucose translocase homolog from prophage CPS-53 (yfdG) can be achieved through this method, which allows for detailed studies of its structure, function, and interactions .

Challenges and Considerations

When studying membrane proteins like yfdG, several factors need consideration . The hydrophobic mismatch, where the length of the transmembrane segments does not match the lipid bilayer thickness, can affect protein structure and function . Biophysical factors, such as the distribution of charged amino acids and the free energy of transmembrane segments, also influence protein insertion and stability in the membrane .

Tools for Studying Membrane Protein Topology

Several tools are available to study membrane protein topology . Fusion reporters, such as GFP and alkaline phosphatase, can be used to determine the orientation of protein segments relative to the cytoplasm and periplasm . Protease accessibility assays can also identify exposed loops and transmembrane regions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
yfdG; b2350; JW2346; Prophage bactoprenol-linked glucose translocase homolog; Bactoprenol-linked glucose translocase homolog from prophage CPS-53
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yfdG
Target Protein Sequence
MLKLFAKYTSIGVLNTLIHWVVFGVCIYVAHTNQALANFAGFVVAVSFSFFANAKFTFKA STTTMRYMLYVGFMGTLSATVGWAADRCALPPMITLVTFSAISLVCGFVYSKFIVFRDAK
Uniprot No.

Target Background

Function

This protein is involved in O antigen modification and the translocation of bactoprenol-linked glucose across the cytoplasmic membrane.

Database Links
Protein Families
GtrA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yfdG and what is its role in E. coli?

The yfdG protein (UniProt ID: P77682) is a bactoprenol-linked glucose translocase homolog encoded within the cryptic prophage CPS-53 of Escherichia coli. This 120-amino acid protein is predicted to function in the translocation of glucose molecules across the bacterial membrane using bactoprenol as a carrier lipid . As part of the CPS-53 prophage element, yfdG exists within a prophage region that has been integrated into the bacterial genome over evolutionary time. Cryptic prophages like CPS-53 constitute up to 20% of bacterial genomes and have been shown to provide multiple benefits to host bacteria for surviving adverse environmental conditions . While the specific function of yfdG has not been fully characterized, its homology to glucose translocases suggests involvement in cell envelope biogenesis processes that may contribute to bacterial stress responses or cellular adaptation.

How is the CPS-53 prophage related to bacterial stress responses?

The CPS-53 prophage has been experimentally demonstrated to contribute significantly to bacterial stress resistance. When researchers precisely deleted all nine prophage elements (including CPS-53) from E. coli, they observed decreased resistance to various stressors. Specifically, CPS-53 was found to play a critical role in protecting against oxidative stress, with its deletion almost completely accounting for the increased sensitivity to oxidative damage observed in the prophage-free strain . Although specific proteins from CPS-53 (YfdK, YfdO, and YfdS) have been identified as enhancing resistance to oxidative stress, the contribution of yfdG to stress responses remains a subject for further investigation . The CPS-53 prophage also appears to influence the transcription of key stress response genes including rpoS (encoding the master stress regulator), oxyR (encoding an oxidative stress sensor), and katE (encoding catalase), as their expression was repressed 3-4 fold in the CPS-53 deletion strain compared to wild-type when challenged with hydrogen peroxide .

How might yfdG function in bactoprenol-mediated glucose translocation?

Bactoprenol (C55-isoprenyl alcohol) is a hydrophobic lipid that plays a crucial role in bacterial cell wall biosynthesis by serving as a carrier molecule that transports peptidoglycan precursors across the cytoplasmic membrane . As a homolog of bactoprenol-linked glucose translocases, yfdG likely participates in a similar mechanism for glucose translocation.

The process would theoretically involve:

  • Activation of glucose through attachment to a nucleotide donor (typically UDP-glucose)

  • Transfer of the glucose to bactoprenol phosphate to form bactoprenol-P-P-glucose

  • Translocation of this complex across the membrane by yfdG

  • Transfer of glucose to an acceptor molecule on the periplasmic side

  • Recycling of bactoprenol-pyrophosphate back to bactoprenol phosphate

Researchers investigating this mechanism could employ radiolabeled glucose precursors and membrane vesicle preparations to track the movement of glucose molecules across membranes in the presence and absence of purified yfdG protein. Inhibitor studies using bactoprenol-targeting antibiotics could provide additional insights into the dependency of yfdG function on the bactoprenol carrier system .

What methodologies are most effective for studying yfdG function?

MethodologyApplication for yfdG ResearchTechnical Considerations
Recombinant protein expressionProduction of purified protein for biochemical assaysExpression as His-tagged protein in E. coli; lyophilized powder should be reconstituted to 0.1-1.0 mg/mL in deionized water with 5-50% glycerol for storage
Membrane reconstitutionAnalysis of transport activityIncorporation into liposomes or nanodiscs with appropriate lipid composition
Site-directed mutagenesisIdentification of functional residuesTarget conserved residues predicted to be involved in substrate binding or transport
In vitro transport assaysCharacterization of glucose translocation activityRequires radiolabeled substrates and methods to separate inside/outside vesicle contents
Bacterial genetic complementationValidation of in vivo functionCompare strains with and without functional yfdG under various stress conditions

For optimal results, researchers should consider using multiple complementary approaches to validate findings. The recombinant protein can be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, and reconstitution should include glycerol addition for long-term storage stability .

How does prophage CPS-53 stability and excision impact yfdG expression?

Unlike some other prophages (such as e14, which shows increased excision rates of up to 356-fold under DNA-damaging conditions), CPS-53 maintains its integrated state even when bacteria are exposed to mitomycin C or oxidative stress . This persistent integration ensures that yfdG remains a functional part of the bacterial genome during stress responses, potentially contributing to adaptive advantages.

Researchers interested in studying the impact of prophage stability on yfdG expression could employ the following approaches:

  • qRT-PCR to measure yfdG transcript levels under various environmental conditions

  • Reporter gene fusions (e.g., yfdG promoter-GFP) to monitor expression at the single-cell level

  • Comparison of phenotypes between wild-type strains and engineered strains with CPS-53 precisely deleted

  • ChIP-seq to identify transcriptional regulators that might control yfdG expression

These methodologies would provide insights into the regulation of yfdG as part of the larger prophage response to environmental conditions.

What is the relationship between yfdG and other CPS-53 prophage proteins?

The CPS-53 prophage encodes multiple proteins that collectively contribute to bacterial physiology and stress responses. While specific interactions between yfdG and other prophage proteins have not been fully characterized, research has identified several CPS-53 proteins with defined functions in stress resistance, particularly YfdK, YfdO, and YfdS, which enhance resistance to oxidative stress .

A comprehensive understanding of yfdG's role within the broader context of CPS-53 function would require:

  • Protein-protein interaction studies (e.g., bacterial two-hybrid, co-immunoprecipitation)

  • Comparative phenotypic analysis of strains with individual gene deletions versus the entire prophage deletion

  • Transcriptomic analysis to identify co-regulated genes within the prophage region

  • Functional complementation studies to determine which proteins can compensate for each other's functions

It's noteworthy that prophage proteins often work cooperatively to confer benefits to the host bacterium. The collaborative functions of multiple CPS-53 proteins, potentially including yfdG, may explain why CPS-53 contributes significantly to E. coli's resistance to oxidative stress and other environmental challenges .

How might yfdG contribute to antibiotic resistance mechanisms?

Bactoprenol-mediated transport systems represent important targets for antibiotics due to their essential role in bacterial cell wall biosynthesis. Several antibiotic compounds disrupt the bactoprenol-mediated transportation pathway, including friulimicin B, nisin, and lantibiotics like NAI-107 . As a homolog of bactoprenol-linked glucose translocases, yfdG might play a role in modifying cell envelope properties that contribute to antibiotic resistance.

Cryptic prophages in E. coli, including CPS-53, have been shown to contribute significantly to resistance against quinolone and β-lactam antibiotics at sub-lethal concentrations . While the specific contribution of yfdG to this resistance has not been directly demonstrated, its putative function in cell envelope modification suggests potential involvement in altering membrane permeability or cell wall structure.

To investigate this possibility, researchers could:

  • Compare minimum inhibitory concentrations (MICs) of various antibiotics in strains with and without functional yfdG

  • Analyze changes in cell envelope composition and structure in yfdG-expressing versus yfdG-deleted strains

  • Investigate potential synergistic effects between yfdG and other prophage-encoded resistance factors

  • Screen for small molecule inhibitors that specifically target yfdG function and assess their impact on antibiotic susceptibility

Such studies would provide valuable insights into the broader role of prophage-encoded functions in bacterial antibiotic resistance mechanisms.

What are the optimal conditions for expressing and purifying recombinant yfdG?

For researchers planning to work with recombinant yfdG protein, careful consideration of expression and purification conditions is essential. The commercially available recombinant yfdG is expressed in E. coli with an N-terminal His-tag, allowing for purification by metal affinity chromatography . Based on the product information, the following recommendations can be made:

  • Expression system: E. coli is suitable for expression of the full-length protein (120 amino acids)

  • Purification method: Ni-NTA affinity chromatography for His-tagged protein

  • Storage buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Storage: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • Working conditions: Store working aliquots at 4°C for up to one week; avoid repeated freeze-thaw cycles

For researchers preparing their own recombinant constructs, designing appropriate expression vectors with removable tags would facilitate both purification and subsequent functional studies. Membrane proteins like yfdG often benefit from expression at lower temperatures (16-25°C) to allow proper folding and membrane insertion.

How can researchers evaluate the glucose translocase activity of yfdG in vitro?

Evaluating the putative glucose translocase activity of yfdG presents several technical challenges. Researchers can employ the following methodological approaches:

  • Liposome reconstitution assay:

    • Purify recombinant yfdG and reconstitute into liposomes

    • Include fluorescently labeled glucose derivatives or radiolabeled glucose inside liposomes

    • Measure glucose translocation by monitoring changes in fluorescence or radioactivity

  • Inverted membrane vesicle preparations:

    • Prepare inverted membrane vesicles from E. coli expressing yfdG

    • Monitor ATP-dependent or proton gradient-dependent glucose transport

  • Bactoprenol-dependent transport assay:

    • Synthesize bactoprenol-phosphate-glucose substrates

    • Measure substrate utilization in the presence of purified yfdG and appropriate acceptor molecules

  • Stopped-flow spectroscopy:

    • Monitor conformational changes in real-time during substrate binding and transport

    • Can provide kinetic parameters for the transport process

These techniques require specialized equipment and expertise but offer complementary approaches to characterize the biochemical function of yfdG as a potential glucose translocase.

What are the major unanswered questions about yfdG function?

Despite its identification as a bactoprenol-linked glucose translocase homolog, several fundamental questions about yfdG remain unanswered:

Addressing these questions would significantly advance our understanding of this prophage-encoded protein and its role in bacterial physiology.

How might high-throughput approaches advance yfdG research?

Modern high-throughput technologies offer promising avenues for elucidating yfdG function:

TechnologyApplication for yfdG ResearchExpected Outcomes
Cryo-electron microscopyStructural determination3D structure revealing membrane topology and potential substrate binding sites
Transposon sequencing (Tn-seq)Identification of genetic interactionsGenes that show synthetic interactions with yfdG under various stress conditions
Ribosome profilingTranslation regulation analysisChanges in yfdG translation efficiency under different growth conditions
MetabolomicsSubstrate identificationDetection of metabolites affected by yfdG activity
ChIP-seqIdentification of regulatory elementsTranscription factors controlling yfdG expression

Integrating data from these approaches would provide a systems-level understanding of yfdG function within the broader context of bacterial physiology and prophage-host interactions.

What are the implications of yfdG research for antibiotic development?

Given that bactoprenol-mediated pathways are targeted by several antibiotics and that prophage elements contribute to antibiotic resistance, understanding yfdG function could have implications for antimicrobial development . If yfdG contributes to modifying cell envelope properties that enhance resistance to certain antibiotics, it might represent a novel target for adjuvant therapies that could sensitize bacteria to existing antibiotics.

Research directions with therapeutic potential include:

  • Screening for specific inhibitors of yfdG function

  • Evaluating combination therapies targeting both yfdG and conventional antibiotic targets

  • Investigating whether yfdG inhibition can reverse resistance to bactoprenol-targeting antibiotics

  • Determining if yfdG contributes to persistence or stress tolerance during antibiotic treatment

These investigations could contribute to addressing the growing challenge of antibiotic resistance in pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.