Recombinant Escherichia coli Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; ECSE_3093; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Escherichia coli (strain SE11)
Target Names
aas
Target Protein Sequence
MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the bifunctional protein aas and what functions does it perform in E. coli?

The aas protein in Escherichia coli is a bifunctional enzyme that performs two distinct enzymatic activities: 2-acylglycerophosphoethanolamine (2-acyl-GPE) acyltransferase and acyl-acyl carrier protein (acyl-ACP) synthetase. These two activities are carried out by the same gene product, as verified through cloning and expression studies . The bifunctional nature of this protein enables it to play a crucial role in phospholipid metabolism, specifically in the acylation of endogenous 2-acyl-GPE and the recycling of membrane lipid components. Research has established that the aas protein is the rate-limiting enzyme in the uptake and incorporation of exogenous 2-acyllysophospholipids into the bacterial membrane .

How is the aas gene expressed and regulated in E. coli?

Regulation likely follows patterns similar to other metabolic enzymes in E. coli, where expression kinetics show that biosynthetic enzymes typically comprise about 15% of cellular proteins during growth in minimal medium . The timing of enzyme expression follows a positive relation between the onset time of enzyme synthesis and the fractional enzyme "reserve" maintained while growing in rich media. This regulatory pattern suggests that aas expression may be upregulated in response to membrane stress or phospholipid precursor depletion .

What methodologies are optimal for recombinant expression and purification of the aas protein?

For successful recombinant expression of the aas protein, the following methodological approach is recommended:

Expression System:

  • Host: E. coli expression strains (BL21(DE3) or derivatives) are commonly used for expressing bacterial proteins

  • Vector: Expression vectors containing T7 promoter systems with N-terminal His-tag for purification purposes

  • Culture Conditions: Growth at 37°C in LB medium until OD600 0.6-0.8, followed by induction with IPTG (0.1-1 mM)

Purification Protocol:

  • Cell Harvest: Centrifugation at 4000 × g

  • Cell Lysis: Sonication or pressure-based lysis in buffer containing 20-50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Clarification: Centrifugation at >15,000 × g for 30 minutes

  • Affinity Chromatography: Nickel affinity purification using His-tag

  • Further Purification: Size exclusion chromatography if needed

  • Storage: 50% glycerol, pH 8.0 at -80°C to maintain activity

Quality Control:

  • Purity: >90% as determined by SDS-PAGE

  • Activity Assay: Acyltransferase activity using 2-acyl-GPE substrates

For optimal reconstitution after lyophilization, protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a cryoprotectant .

How can the dual enzymatic activities of aas be measured and differentiated in experimental settings?

Measuring the dual enzymatic activities of the aas protein requires distinct assay systems for each function:

2-acyl-GPE Acyltransferase Activity:

  • In vitro assay using radiolabeled substrates:

    • Prepare reaction mixture containing:

      • Purified aas protein (1-10 μg)

      • Radiolabeled 2-acyl-GPE substrate (typically 14C or 3H labeled)

      • Acyl donor (acyl-ACP or acyl-CoA)

      • Buffer: 50 mM Tris-HCl (pH 7.5), 10 mM MgCl2

    • Incubate at 30°C for 15-30 minutes

    • Extract lipids using chloroform/methanol (2:1 v/v)

    • Separate by thin-layer chromatography (TLC)

    • Quantify radioactivity in the diacyl-GPE spot

Acyl-ACP Synthetase Activity:

  • ATP-PPi exchange assay:

    • Measure the incorporation of 32P from [32P]PPi into ATP

    • Reaction mixture containing:

      • Purified aas protein

      • Fatty acid substrate

      • ACP

      • ATP

      • [32P]PPi

      • Buffer: 50 mM Tris-HCl (pH 8.0), 10 mM MgCl2, 2 mM DTT

    • After incubation, separate ATP by TLC and quantify radioactivity

  • Direct acylation assay:

    • Measure the formation of acyl-ACP using:

      • Purified aas protein

      • Radiolabeled fatty acid

      • ACP

      • ATP

    • Separate products by native PAGE or HPLC

    • Quantify labeled acyl-ACP formation

These methodologies can distinguish between the two activities and allow researchers to study factors affecting each function independently.

What are the structural domains involved in the dual functionality of aas and how do they interact?

The bifunctional aas protein contains distinct structural domains that support its dual enzymatic activities:

Domain Organization:
Comparison of the predicted amino acid sequence with other acyl-CoA synthetases reveals three conserved domains that are postulated to form the acyl-AMP binding pocket . These domains are likely arranged similarly to other bifunctional proteins in E. coli, such as the rfaE gene product, which contains two clearly separated domains with distinct functions .

The functional organization can be inferred to include:

  • An N-terminal domain responsible for acyl-ACP synthetase activity

  • A C-terminal domain mediating the 2-acyl-GPE acyltransferase activity

  • A central region containing the conserved acyl-AMP binding pocket

Domain Interaction Model:
Similar to other bifunctional proteins in E. coli, the domains might function independently but coordinate activities through:

  • Substrate channeling between active sites

  • Conformational changes upon substrate binding

  • Allosteric regulation between domains

Research methodologies to study domain interactions include:

  • Limited proteolysis to identify domain boundaries

  • Expression of individual domains to test independent function

  • Site-directed mutagenesis of residues at domain interfaces

  • Structural studies using X-ray crystallography or cryo-EM

The rfaE gene example from E. coli demonstrated that its two domains (amino acids 1-318 and 344-477) could be expressed individually with Domain I complementing specific mutations while Domain II remained functionally distinct . This suggests a potential approach for studying aas domain functionality.

How does aas coordinate with the LplT lysophospholipid transporter in membrane lipid remodeling?

The aas protein functions cooperatively with the LplT lysophospholipid transporter in a two-component system for membrane lipid remodeling:

Functional Coordination Mechanism:

  • LplT translocates lysophospholipids (particularly 2-acyl lyso-PE) from the periplasmic leaflet to the cytoplasmic leaflet of the inner membrane

  • Aas, located on the cytoplasmic side, reacylates these lysophospholipids to form complete phospholipids

  • This coordinated process allows for recycling of membrane components and incorporation of exogenous fatty acids

Experimental Evidence of Interaction:
Research has demonstrated this coordination through:

  • TLC-based LPL translocation assays showing Aas-dependent formation of diacyl lipids from translocated lysophospholipids

  • Studies with ΔlplT, Δaas, and ΔlplT/aas mutant strains showing defects in lysophospholipid transport and reacylation

Methodological Approach to Study This Interaction:

  • Preparation of E. coli Spheroplasts:

    • Culture E. coli WT or ΔlplT, Δaas, and ΔlplT/aas mutant strains

    • Prepare spheroplasts using the lysozyme-EDTA method

    • Resuspend in appropriate buffer (spheroplast solution B)

  • Transport Assay Protocol:

    • Add radioactive LPLs to spheroplast solutions

    • Terminate reactions at specific timepoints

    • Extract total lipids using chloroform/methanol

    • Separate by TLC and quantify reacylated products

    • Compare results between wild-type and mutant strains

This methodological approach allows researchers to quantitatively assess the functional relationship between LplT and Aas in membrane lipid remodeling.

How can isotope labeling strategies be employed to study aas-mediated lipid metabolism in E. coli?

Isotope labeling provides powerful tools for tracing the fate of substrates in aas-mediated lipid metabolism:

Hydrogen Isotope (δ2H) Labeling Strategy:

  • Experimental Design:

    • Grow E. coli in media with varying δ2H values in water (-55‰ to +1,070‰)

    • Extract and analyze individual amino acids and lipid components

    • Determine incorporation patterns of hydrogen from water versus substrate

  • Analytical Methods:

    • Gas chromatography-isotope ratio mass spectrometry (GC-IRMS)

    • Liquid chromatography-mass spectrometry (LC-MS) for compound-specific isotope analysis

  • Data Interpretation:

    • Model calculations can determine the percentage of hydrogen originating from water versus substrate

    • For lipid metabolism studies, this approach can reveal how aas incorporates hydrogen during acyl transfer reactions

Carbon-13 Labeling Approach:

  • Pulse-Chase Experiments:

    • Feed E. coli with 13C-labeled fatty acids or lysophospholipids

    • Monitor incorporation into membrane lipids over time

    • Quantify the rate and specificity of aas-mediated incorporation

  • Metabolic Flux Analysis:

    • Use 13C-labeled glucose and trace carbon flow through central metabolism to lipid biosynthesis

    • Construct mathematical models to quantify fluxes through aas-dependent pathways

    • Compare wild-type and aas mutant strains to determine metabolic impact

These isotope labeling strategies provide quantitative insights into aas function that cannot be obtained through conventional biochemical methods.

What genetic and molecular approaches can be used to study aas function in vivo?

Multiple complementary approaches can be employed to study aas function in living cells:

Gene Deletion and Complementation:

  • Generate Δaas knockout strain using CRISPR-Cas9 or recombineering techniques

  • Characterize phenotypic changes in membrane composition and integrity

  • Complement with wild-type or mutant versions of aas to restore function

  • Quantify restoration of phenotype to determine critical residues for function

Site-Directed Mutagenesis:

  • Introduce point mutations in conserved domains

  • Express mutant proteins and assess impact on:

    • Protein stability and expression

    • Individual enzymatic activities

    • Membrane lipid composition

    • Cell growth under various stress conditions

Chemoproteomics Approaches:
Based on chemoproteomic-detected amino acids (CpDAA) methodology:

  • Detect reactive residues in aas using activity-based protein profiling

  • Map these residues to genomic coordinates

  • Correlate with predicted pathogenicity scores to identify functionally critical residues

  • Use this information to guide mutagenesis studies

Fluorescent Protein Fusions:

  • Generate C- or N-terminal GFP fusions with aas

  • Visualize subcellular localization under various conditions

  • Perform FRAP (Fluorescence Recovery After Photobleaching) to study membrane dynamics

These approaches provide comprehensive insights into aas function in living cells, connecting molecular mechanisms to physiological roles.

How does aas activity impact bacterial stress response and adaptation to environmental challenges?

The aas protein plays significant roles in bacterial stress responses, particularly those affecting membrane integrity:

Acid Stress Response:
Acid resistance (AR) studies in E. coli have shown that membrane lipid composition affects survival in acidic environments. The aas protein, by maintaining proper membrane phospholipid composition, likely contributes to acid resistance mechanisms. Methodological approaches to study this include:

  • Exposing wild-type and Δaas mutant strains to acetic acid solutions (AAS) at pH 3.2

  • Measuring survival rates with or without glutamic acid supplementation

  • Correlating membrane phospholipid composition with acid resistance profiles

Membrane Stress Response:
During stress conditions that activate phospholipases (e.g., detergent-resistant PldA phospholipase A1), aas functions to:

  • Reacylate the resulting lysophospholipids to maintain membrane integrity

  • Prevent accumulation of potentially detergent-like lysophospholipids

  • Recycle fatty acids released during stress-induced phospholipid turnover

Metabolic Adaptation:
The aas protein's role in incorporating exogenous fatty acids provides metabolic flexibility during nutrient limitation. Studies have shown:

  • Strains with multiple copies of the aas gene show higher specific activities for incorporation of exogenous fatty acids and lysophospholipids

  • This may provide adaptive advantages in environments with available lipid materials

Research Methodology for Stress Studies:
To study aas function during stress:

  • Subject wild-type and Δaas strains to various stresses (acid, osmotic, oxidative)

  • Monitor changes in membrane composition using lipidomics

  • Measure stress-specific marker expression (e.g., stress-response genes)

  • Assess phenotypic outcomes such as growth rate, survival, and membrane permeability

Understanding these stress-response functions could lead to applications in engineering more robust bacterial strains for biotechnological applications.

What are the optimal buffer conditions for maintaining aas enzyme activity in vitro?

Based on experimental protocols for studying aas and similar bifunctional enzymes, the following buffer conditions are recommended:

Storage Buffer Composition:

  • Tris/PBS-based buffer, pH 8.0

  • 6% Trehalose as stabilizer

  • 50% Glycerol for long-term stability

  • Storage temperature: -20°C to -80°C

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

Activity Assay Buffer:
For acyltransferase activity:

  • 50 mM Tris-HCl, pH 7.5

  • 10 mM MgCl₂

  • 1-2 mM DTT (to maintain reduced state)

  • 0.1% Triton X-100 (optional, to facilitate substrate accessibility)

For acyl-ACP synthetase activity:

  • 50 mM Tris-HCl, pH 8.0

  • 10 mM MgCl₂

  • 2 mM DTT

  • 5 mM ATP

Stability Considerations:

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freezing and thawing significantly reduces activity

  • Activity is maintained best when stored in buffer containing reducing agents and glycerol

These buffer conditions are critical for maintaining the dual enzymatic activities of the aas protein during in vitro studies.

What are the challenges in developing a kinetic model for aas activity in the context of E. coli metabolism?

Developing a comprehensive kinetic model for aas activity presents several challenges that must be addressed using advanced computational and experimental approaches:

Core Challenges in Kinetic Modeling:

  • Dual Enzymatic Activities:

    • The bifunctional nature of aas requires modeling two distinct enzymatic mechanisms

    • Parameters must account for potential interactions between the two activities

    • Need to determine if activities occur simultaneously or sequentially

  • Integration with Genome-Scale Models:

    • Aas functions must be integrated into genome-scale metabolic models like k-ecoli457

    • Parameters must be consistent with fluxomic data across multiple strains and conditions

    • Model must incorporate substrate-level regulatory interactions (295 such interactions exist in k-ecoli457)

  • Parameter Estimation:

    • Enzyme kinetic parameters (kcat, Km) must be experimentally determined for:

      • Multiple substrates (various lysophospholipids, fatty acids, ATP, ACP)

      • Different reaction conditions (pH, temperature, ionic strength)

    • Similar to aminoacyl-tRNA synthetase modeling, which requires extensive parametrization

Methodological Approach for Kinetic Modeling:

  • Parameter Determination:

    • Conduct in vitro steady-state kinetic assays for both enzymatic activities

    • Determine kcat and Km values for all substrates

    • Measure product inhibition constants and regulatory effects

  • Model Construction:

    • Develop separate rate equations for each enzymatic activity

    • Incorporate allosteric regulation and feedback inhibition

    • Link models through shared metabolites and cofactors

  • Model Validation:

    • Test predictions against experimental measurements in wild-type E. coli

    • Validate using mutant strains with altered aas expression

    • Iteratively refine parameters to improve prediction accuracy

  • Integration with Whole-Cell Models:

    • Connect aas kinetic model to genome-scale models like k-ecoli457

    • Use genetic algorithm approaches for parameterization across multiple datasets

    • Evaluate model performance using metrics like Pearson correlation between experimental and predicted values

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.