Recombinant Escherichia coli Biofilm PGA synthesis protein PgaD (pgaD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
pgaD; ycdP; b1021; JW1006; Biofilm PGA synthesis protein PgaD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pgaD
Target Protein Sequence
MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT SQGQIKMVVSEKALVRA
Uniprot No.

Target Background

Function

Essential for the synthesis of poly-β-1,6-N-acetyl-D-glucosamine (PGA), a polysaccharide biofilm adhesin. It may also facilitate the PGA polymerization activity of the glycosyltransferase PgaC.

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of PgaD in Escherichia coli biofilm formation?

PgaD is a crucial component of the pgaABCD locus (formerly known as ycdSRQP) that is essential for optimal biofilm formation in E. coli under various growth conditions. The protein specifically contributes to the synthesis of poly-β-1,6-N-acetyl-d-glucosamine (PGA), an adhesin polysaccharide that facilitates both abiotic surface binding and intercellular adhesion . The entire pgaABCD operon encodes envelope proteins involved in the synthesis, translocation, and likely surface attachment of this polysaccharide . Researchers have demonstrated that all genes in this operon, including pgaD, are required for full biofilm development capabilities in E. coli .

How does the pgaABCD operon relate to bacterial surface attachment?

The pgaABCD operon promotes bacterial surface attachment through several interconnected mechanisms:

  • Synthesis of adhesin polysaccharide: The operon encodes proteins that produce PGA, a polymer previously unknown in gram-negative bacteria but shown to function as an adhesin .

  • Surface binding facilitation: The PGA polysaccharide mediates initial attachment to abiotic surfaces, which is a crucial first step in biofilm formation .

  • Intercellular cohesion: Beyond surface attachment, PGA also promotes cell-to-cell adhesion, which strengthens the developing biofilm structure .

  • Biofilm stability: When biofilms are treated with metaperiodate (which degrades polysaccharides), they disperse and release intact cells, confirming PGA's structural role - whereas protease treatment has no effect .

This multi-faceted role makes the pgaABCD operon central to E. coli's ability to form stable biofilms on various surfaces.

What experimental evidence confirms PgaD's role in PGA synthesis?

Multiple lines of experimental evidence confirm PgaD's involvement in PGA synthesis:

  • Mutational studies: Deletion mutants lacking pgaD show severely impaired biofilm formation capabilities under various growth conditions .

  • Biochemical analysis: Researchers have isolated a cell-bound polysaccharide dependent on the pga genes and confirmed through nuclear magnetic resonance analyses that it consists of unbranched β-1,6-N-acetyl-d-glucosamine .

  • Correlation with regulatory molecules: PgaD protein levels directly correlate with intracellular concentrations of cyclic dimeric GMP (c-di-GMP), a second messenger that regulates biofilm formation .

  • Chemical dispersion tests: Biofilms dependent on PGA (and thus PgaD function) disperse when treated with metaperiodate but remain intact when treated with proteases, confirming the polysaccharide nature of the adhesin .

These findings collectively establish PgaD as an essential component of the PGA synthesis machinery in E. coli.

How does c-di-GMP regulation affect PgaD expression and function?

The relationship between cyclic dimeric GMP (c-di-GMP) and PgaD represents a sophisticated regulatory mechanism in biofilm formation:

  • Protein level correlation: Research has established that PgaD-3×Flag protein levels directly correlate with intracellular c-di-GMP concentrations, suggesting post-transcriptional regulation .

  • DgcZ mediation: The diguanylate cyclase DgcZ (which synthesizes c-di-GMP) plays a crucial intermediary role in regulating PGA biosynthesis, with PgaD serving as a key downstream target .

  • Integrative regulation: DgcZ appears to integrate multiple environmental and cellular signals to modulate PgaD activity and subsequent biofilm formation .

  • CpxAR regulatory influence: The two-component system CpxAR, which is activated by the lipoprotein NlpE during surface sensing, regulates transcription of dgcZ, creating a regulatory cascade that ultimately affects PgaD function .

This multi-tiered regulatory network allows precise control of PgaD activity in response to environmental conditions, illustrating the complexity of biofilm regulation in E. coli.

What structural characteristics of PgaD are essential for its functionality?

While comprehensive structural data for PgaD is limited in the provided search results, functional analysis suggests several important characteristics:

  • Membrane association: As part of the PGA synthesis machinery, PgaD likely functions in association with the bacterial envelope .

  • Protein-protein interactions: PgaD must interact with other components of the pgaABCD operon to facilitate coordinated PGA synthesis .

  • c-di-GMP binding domains: Given the correlation between PgaD levels and c-di-GMP concentration, the protein likely contains domains that directly or indirectly respond to this second messenger .

  • Conservation across species: The pgaABCD operon exhibits features consistent with horizontal gene transfer and appears in various eubacteria, suggesting evolutionarily conserved structural elements that maintain PgaD function .

Future structural studies using X-ray crystallography or cryo-electron microscopy would significantly enhance our understanding of PgaD's functional domains and interaction surfaces.

What interrelationships exist between PgaD and other biofilm-associated regulatory networks?

PgaD functions within a complex network of biofilm regulators, with several noteworthy interactions:

  • DgcZ-mediated regulation: DgcZ plays a central role in connecting surface sensing to PgaD-dependent PGA synthesis .

  • CpxAR two-component system: This system regulates dgcZ transcription in response to surface contact through the lipoprotein NlpE, establishing a regulatory pathway from surface sensing to PgaD activity .

  • Fumarate reductase complex (FRD): Evidence from coimmunoprecipitation studies suggests potential interaction between DgcZ and FrdB, a subunit of the FRD complex involved in anaerobic respiration and flagellum assembly control, which may indirectly impact PgaD function .

  • Oxidative stress response: The FRD complex is required for increased DgcZ-mediated biofilm formation under oxidative stress conditions (e.g., paraquat exposure), suggesting integration of the PgaD/PGA pathway with stress response mechanisms .

This interconnected regulatory landscape highlights the sophisticated coordination of biofilm development with other cellular processes in E. coli.

What approaches are effective for measuring PgaD protein expression levels?

Several methodological approaches can effectively quantify PgaD expression:

MethodApplicationAdvantagesLimitations
Western BlottingProtein quantificationAllows detection of tagged PgaD (e.g., PgaD-3×Flag)Requires specific antibodies or epitope tagging
qRT-PCRTranscriptional analysisMeasures pgaD mRNA levelsDoes not account for post-transcriptional regulation
GFP/fluorescent protein fusionIn vivo expressionReal-time visualization in living cellsMay affect protein function
Mass spectrometryProtein identification/quantificationHigh sensitivity and specificityComplex sample preparation

For most accurate results, combining transcriptional analysis with protein-level quantification is recommended. For instance, researchers have successfully employed PgaD-3×Flag constructs to monitor protein levels in relation to c-di-GMP concentrations . When designing such experiments, it's essential to verify that epitope tags do not interfere with normal protein function or interactions within the PGA synthesis machinery.

How can researchers effectively disrupt or modulate PgaD function in experimental settings?

Several approaches can be employed to manipulate PgaD function:

  • Gene knockout/deletion: Creating ΔpgaD mutants using techniques like lambda Red recombineering can completely eliminate PgaD function, allowing assessment of biofilm formation in its absence .

  • Controlled expression systems: Placing pgaD under inducible promoters (e.g., IPTG- or arabinose-inducible) enables titration of expression levels to study dose-dependent effects.

  • Site-directed mutagenesis: Creating point mutations at predicted functional residues can identify critical domains while maintaining protein expression.

  • Chemical modulation: Manipulating c-di-GMP levels (through DgcZ regulation or direct addition of c-di-GMP analogs) can indirectly modulate PgaD activity .

  • Chemical dispersion: Using metaperiodate treatment to disrupt PGA can help assess PgaD's contribution to established biofilms .

When selecting an approach, researchers should consider how completely they wish to disrupt PgaD function and whether they need temporal control over the disruption.

What protocols are most effective for isolating and characterizing PGA polysaccharide produced by PgaD and associated proteins?

Isolation and characterization of PGA requires specialized techniques:

StepMethodKey Considerations
ExtractionCell-bound polysaccharide isolationRequires careful separation from cellular components
PurificationSize-exclusion chromatographyMolecular weight determination and removal of contaminants
Structural analysisNuclear magnetic resonance (NMR)Can confirm unbranched β-1,6-N-acetyl-d-glucosamine structure
Functional testingBiofilm dispersal assaysMetaperiodate treatment should disperse biofilms if PGA is present
QuantificationColorimetric assaysCan quantify polysaccharide production under different conditions

Researchers have successfully employed NMR analysis to determine that PGA consists of unbranched β-1,6-N-acetyl-d-glucosamine, a polymer previously unknown in gram-negative bacteria . When designing isolation protocols, it's important to include appropriate controls, particularly testing the absence of the polysaccharide in pgaD deletion mutants.

How can researchers differentiate between direct PgaD effects and indirect regulatory pathway contributions in biofilm phenotypes?

Distinguishing direct from indirect effects requires systematic approaches:

  • Genetic complementation: Reintroducing pgaD on a plasmid in a ΔpgaD background can confirm direct contributions to phenotypes.

  • Epistasis analysis: Testing double mutants (e.g., ΔpgaD with mutations in regulatory genes like dgcZ) can reveal pathway relationships and hierarchy .

  • Controlled expression systems: Using inducible systems to express PgaD in the absence of normal regulatory inputs can isolate direct effects.

  • Biochemical reconstitution: In vitro systems with purified components can demonstrate direct activities without cellular context.

  • Time-course studies: Analyzing the temporal sequence of events after inducing expression can help separate primary from secondary effects.

For example, researchers investigating DgcZ's role showed that both the negative effect of a cpxR mutation and the positive effect of nlpE overexpression on biofilm formation depended on DgcZ, placing DgcZ downstream in the regulatory pathway . Similar approaches can be applied to position PgaD correctly within regulatory networks.

What are the most common technical challenges in expressing and purifying recombinant PgaD protein?

Researchers frequently encounter these challenges when working with recombinant PgaD:

ChallengePotential SolutionsConsiderations
InsolubilityUse solubility tags (MBP, SUMO); optimize extraction buffersTags may affect function and should be removable
Low expressionCodon optimization; test different host strains; lower induction temperatureExpression conditions may need significant optimization
Protein instabilityInclude protease inhibitors; express with chaperonesStability issues may indicate improper folding
Function verificationDevelop activity assays; test for complementationEssential to confirm that recombinant protein is functional
Protein-protein interactionsCo-expression with other Pga proteinsMay be necessary for proper folding or function

When troubleshooting expression issues, systematic variation of expression conditions (temperature, induction time, media composition) combined with solubility screening can help identify optimal parameters for producing functional recombinant PgaD.

How might the understanding of PgaD function advance biofilm control strategies in clinical and industrial settings?

Understanding PgaD opens several promising research avenues:

  • Anti-biofilm therapeutics: PgaD could serve as a target for novel antibiofilm compounds that specifically disrupt PGA synthesis without affecting bacterial viability, potentially reducing selection pressure for resistance.

  • Biomarker development: PgaD activity or PGA presence could serve as biomarkers for biofilm-forming potential in clinical isolates.

  • Synthetic biology applications: Engineered PgaD variants could allow controlled biofilm formation for beneficial applications in bioremediation or industrial biocatalysis.

  • Cross-species comparative analysis: Since homologous loci are present in various bacterial pathogens, comparative studies could reveal species-specific adaptations of PGA synthesis .

  • Structure-based drug design: Determination of PgaD's structure could enable rational design of inhibitors for biofilm prevention.

The horizontally transferred nature of the pgaABCD operon and its presence across multiple bacterial species suggests that insights gained from E. coli studies may have broad applicability to biofilm control in diverse settings .

What emerging technologies might enhance our understanding of PgaD regulation and function?

Several cutting-edge approaches show promise for advancing PgaD research:

  • Cryo-electron microscopy: Could resolve the structure of the entire PGA synthesis machinery, including PgaD in its native membrane context.

  • Single-cell analysis: Technologies like microfluidics combined with fluorescent reporters could reveal cell-to-cell variability in PgaD expression and activity during biofilm formation.

  • Super-resolution microscopy: Could visualize the spatial organization of PgaD and other Pga proteins during different stages of biofilm development.

  • Proteomics approaches: Thermal proteome profiling or similar techniques could identify previously unknown interaction partners for PgaD.

  • Systems biology integration: Multi-omics approaches could position PgaD within the broader networks controlling the transition from planktonic to biofilm lifestyles.

These technologies would help address current knowledge gaps, particularly regarding the temporal and spatial dynamics of PgaD activity during biofilm formation and the complete interactome of PgaD within the bacterial cell.

How does evolutionary conservation of PgaD across bacterial species inform functional predictions?

The evolutionary aspects of PgaD offer valuable research insights:

  • Comparative genomics: The pgaABCD operon exhibits features consistent with horizontal gene transfer and is present across various eubacteria , suggesting strong selective pressure maintaining its function.

  • Structure-function conservation: Identifying conserved domains across species can highlight functionally critical regions that could serve as targets for broad-spectrum biofilm inhibitors.

  • Host-specific adaptations: Comparing PgaD variants from different ecological niches could reveal how the protein has adapted to diverse environments.

  • Polysaccharide diversity: While E. coli produces unbranched β-1,6-N-acetyl-d-glucosamine , related species may produce structurally modified versions with altered properties.

  • Regulatory divergence: Despite conservation of the core machinery, regulatory mechanisms controlling PgaD expression may vary significantly between species.

Research into these evolutionary aspects would strengthen our fundamental understanding of biofilm formation while potentially revealing novel intervention points with broad applicability across bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.